KEGG   Loa loa (eye worm): LOAG_05308
Entry
LOAG_05308        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12587  exosome complex component MTR3
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_05308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_05308
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_05308
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 9942711
NCBI-ProteinID: XP_003140893
UniProt: A0A1I7W4I8
AA seq 264 aa
MQHSSVKPVPLNNLLKRTENIEVGTSLENASNSFRSIVMQTGALHDQKGTVYVEFGSTKI
ICSVDGPKEITKSADVNPTEGQVYVFLKNISTEGNAVSGSNSSSVSNKEINGTRNAVESA
LRSIVCLELFCKAQIDVEITVLNDDGGVLAASLIASSLALVDSGIQVYDVCVAAHIVMLT
DGRIIVDPSTNSYPFSSIPDSEEFSGNTHLSVTVGMMPSLNQLACCEFVGIAEPHQLRHA
ITVAVESSLKLYPLVRKTLTSNMI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcaacattcttcggtgaagccggtacccttaaataatcttttaaaacgaacagaaaat
attgaagttggaacaagtttggaaaatgcatcgaattcattccgatctattgtaatgcaa
acaggtgctttgcatgatcagaaaggtacggtttatgttgaatttggttcaacgaaaatt
atttgttcagttgatggtcctaaagaaataacgaaaagtgctgatgttaatccaacggaa
gggcaagtttatgtttttctgaagaatatttcaacggaaggcaatgccgtctcaggctca
aattcttcctcagtttcaaataaagaaatcaatgggacgcgtaatgccgtggaatcggct
ttacgatcaattgtttgtttggagttattttgtaaagcacagattgatgttgaaataacg
gttctcaatgatgatggtggtgttttggcggcttctttaatagcttcttccttagcttta
gtcgattctggtatccaagtttatgatgtttgtgtagcagctcatatcgttatgttgaca
gatggccgtatcattgttgacccgtcaactaactcatatccgttttcttctatacctgat
tcagaggaattctccggaaatacgcatctttcagttaccgttggcatgatgccgtcacta
aatcagttagcatgttgtgaatttgttggcattgcagaacctcaccagttaaggcatgct
attactgtagccgtagaaagttcattgaagttatatccactggtacgtaaaacacttacc
agcaatatgatataa

DBGET integrated database retrieval system