KEGG   Loa loa (eye worm): LOAG_05563
Entry
LOAG_05563        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05770  translocator protein
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_05563
Transporters [BR:loa02000]
 Other transporters
  Others
   LOAG_05563
SSDB
Motif
Pfam: TspO_MBR
Other DBs
NCBI-GeneID: 9942980
NCBI-ProteinID: XP_020302811
AA seq 204 aa
MAESLFTYRYNDIVRDAPTFGYGTKHVSMNSIWTSSDTKRAVLFSLVPGALSSYVAASFR
KEKNLFDWWFALNKPNWAPENPAIYGLLDVVTIAPVGWASYMAYKYGGGLAHHDTKLALA
LYGSSMICAFLTMPLVIRKNCRCLFRNTLIMHLTAAGAALTFFKIDHNAGLLLVPYVMWT
GFYTFLTYAMKKMNTSEASEHPTL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggccgaatcactgttcacctatcgttataatgatattgtacgtgatgctccaactttt
ggatatggtacaaaacatgttagcatgaattcaatttggacatccagtgacacaaaacgt
gccgttctattttcactggtaccaggtgcattatcgtcatatgtcgcagcatcatttagg
aaggaaaaaaatttgttcgattggtggtttgcattaaataaaccaaattgggcaccggaa
aatccggcaatttatggtttactcgatgtcgtgacaattgcgcccgtcggttgggcgtca
tatatggcatataagtatggcggaggtcttgcacatcatgatacaaagttagcattggca
ttatatggtagtagtatgatttgtgcatttcttacaatgccattggtgataagaaagaat
tgtcgttgtttattccgtaacacgcttataatgcatttgactgcagctggagcagcactt
acattctttaagattgatcacaacgctggcttattattagtaccatacgttatgtggaca
ggcttttacacgttcctcacgtacgccatgaaaaaaatgaacacatctgaagcaagtgaa
catccaactctttaa

KEGG   Loa loa (eye worm): LOAG_05565
Entry
LOAG_05565        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05770  translocator protein
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_05565
Transporters [BR:loa02000]
 Other transporters
  Others
   LOAG_05565
SSDB
Motif
Pfam: TspO_MBR
Other DBs
NCBI-GeneID: 9942981
NCBI-ProteinID: XP_003141153
UniProt: A0A1I7VE89
AA seq 162 aa
MKRAILTALVPGAVGLISSIPYSKSSNFIEWWNSCKKPDWAPKSLYTYACMDALTITPVG
YASYFIYKYGGGLNNALTALSLGLYGSNLMLCSASLSFMKKKDIKAVYYFSIAVHLTATG
SAIIAYKINRCTGLLMVPYVLWTGFYTFTLYVMKNLNSEIKN
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaaacgcgccattctaacagcattggtaccgggcgctgttggacttattagttctata
ccatattcaaaatcaagcaattttattgaatggtggaattcttgcaaaaaaccggattgg
gcaccaaaatcattgtatacctatgcatgcatggatgcattaacaattacaccagttggt
tatgcgagttattttatttataaatatggtggtggtttgaataatgcgctaacagcacta
tcacttggtttatatggtagtaatttgatgttatgctctgcatcattatcatttatgaaa
aagaaagatataaaagctgtgtattacttttcaattgctgttcatctaacggcaactgga
tcagctattatcgcctataagattaatcgttgcactggtctattgatggtaccatacgta
ctgtggactggtttttatacgttcacgctgtatgtgatgaaaaatctgaattcagaaatc
aaaaattaa

KEGG   Loa loa (eye worm): LOAG_05567
Entry
LOAG_05567        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05770  translocator protein
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05567
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_05567
Transporters [BR:loa02000]
 Other transporters
  Others
   LOAG_05567
SSDB
Motif
Pfam: TspO_MBR
Other DBs
NCBI-GeneID: 9942977
NCBI-ProteinID: XP_003141154
UniProt: A0A1I7VEA3
AA seq 171 aa
MYIHHDFIRHVKRLGSEVIWTTNDTKYSIAWSLVPCAISLNSFLSVSNNQCLTKNWEVAK
EQYIYGLLDILTMLPLGYASYRIYKYGGGFMYNDTKIALGLYGITLLFSLFSLPFTKAKN
RSSQFTHTLLMYLATLGTTYTFHKIDNKACILTIPYTVWTGYYTLLAYAMK
NT seq 516 nt   +upstreamnt  +downstreamnt
atgtatatacatcacgatttcatacgacatgtaaaacgtcttggatcggaagtaatttgg
acaacaaatgatacgaaatattccatagcctggtcactagtaccatgtgctatatcatta
aattcattcttgtctgtttcaaataatcagtgtttgacaaaaaattgggaagtagcaaag
gagcaatatatttatggattattggatattttaacgatgctaccacttggctatgcttct
tatcgtatctataaatacggtggaggcttcatgtacaatgatacaaaaatcgcattagga
ctttatgggatcactttactgttctcattattttcgcttcctttcacaaaagcgaaaaat
cgttcttctcaattcactcatactcttttaatgtatttagcaacacttgggacaacttat
acatttcataagattgataacaaagcttgtatacttacaataccatacactgtatggacc
ggatattatacactgcttgcatatgcgatgaagtga

KEGG   Loa loa (eye worm): LOAG_05568
Entry
LOAG_05568        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K05770  translocator protein
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_05568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:loa02000]
    LOAG_05568
Transporters [BR:loa02000]
 Other transporters
  Others
   LOAG_05568
SSDB
Motif
Pfam: TspO_MBR
Other DBs
NCBI-GeneID: 9942978
NCBI-ProteinID: XP_020302812
AA seq 175 aa
MRRFGMEPIWTSEDTRNAILASLIPGATAFTAFAVFANDRSVVDWWTHAKKPDWAPKNPL
VYSVCDIATLSPLGYASYLVYKNGGGLQYSDTKVALGLYGLNMVFALTTIPLIKKRSFTS
LFRNTVLLNAAAIGAAFAFYKIDKTAGQLLLPYAIWTGFYAVLTYSMSKENVSEH
NT seq 528 nt   +upstreamnt  +downstreamnt
atgagacgtttcggaatggaaccaatttggacatcagaagatactagaaatgctattctg
gctagcctgatacctggtgccactgcttttactgcatttgctgtttttgcaaacgatcgc
agcgttgtagattggtggacacatgcaaaaaagccagattgggctccaaagaatccattg
gtatattccgtttgtgatattgcaacacttagccctttgggctatgcatcttaccttgtt
tataagaacggaggtggtttacagtacagtgacacgaaggttgcccttggattgtatgga
ttaaacatggtttttgctctcacaacaattcctttgatcaagaagagaagttttacttct
ttgtttcgaaacacagtacttttgaatgcagcagcaattggcgcagcgttcgcgttttac
aagattgataaaacagccggtcagcttctgcttccatacgctatttggactggattttac
gctgttcttacttattctatgagtaaggaaaatgtgtcggaacactaa

DBGET integrated database retrieval system