KEGG   Loa loa (eye worm): LOAG_05671
Entry
LOAG_05671        CDS       T02664                                 

Name
(RefSeq) PAP/25A associated domain-containing protein
  KO
K03514  non-canonical poly(A) RNA polymerase PAPD5/7 [EC:2.7.7.19]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_05671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_05671
   03016 Transfer RNA biogenesis [BR:loa03016]
    LOAG_05671
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     LOAG_05671
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     LOAG_05671
Transfer RNA biogenesis [BR:loa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    LOAG_05671
SSDB
Motif
Pfam: PAP_assoc TUTase NTP_transf_2
Other DBs
NCBI-GeneID: 9943079
NCBI-ProteinID: XP_003141256
UniProt: A0A1I7VY72
AA seq 419 aa
MILKDNIPKVAGQCGSVPSSSSDGEEEVLNFTADSSDRVYWPPRENTALIAPWCRRRYAL
SLRGLHEELLDLYAWLKPSPLEKALRLRVFERVRGVLQRIWPTAKIDVFGSLYTSLFLPT
SDIDVVVESDLVSEEPPLWKTAVALKESGITESINVLDKAFVPIVKMVDKDTKIYLDISF
NTVQGVRSARFIEDMKMRYPVLEPLVLVLKQFLMQRQLNQVFTGGLSSYGLILMLISFLQ
LHPSYDYSYKGITEVNMGVLLLSFLQLYGQEFNYMKTALRIHSGGAYVCKDEILVQMNRP
SNSMLCIEDPLQPGNDIGRCSHNIQLVRQAFEHAFATLCAVFVRSREYSTVWRARYHGSL
LSLIMHISPRMIRYRNWLKGRVLSDGTSSPSLSKASTPENFSPSLLNTSLISHLSSPNV
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgattttgaaagataatattcctaaggtagctggtcaatgtggttctgttccttcaagc
agttcggatggggaagaggaagtgttgaatttcacagcagattcttcggatcgtgtgtac
tggccaccgagagaaaatactgcgttgattgcaccgtggtgtcgacggagatatgcactt
tctttgcgagggttacacgaagaattactggatttatatgcgtggttgaagccttcccca
ctggagaaagcattacgacttcgtgtgtttgaacgagttcgtggagtccttcaacgaatt
tggccaacagcaaagattgatgtgtttggcagcttgtacacgagcttgtttttgcctacc
tcagacatcgacgtggttgtggaaagtgatttagtgagtgaggaaccacctctttggaaa
acggcagtagcattaaaagaatctggaatcacggaatcaatcaatgtgcttgacaaagca
tttgtaccaatcgtaaaaatggtcgacaaggataccaaaatatatctagatatatcattc
aatacagtacaaggtgtgcgttcggcgaggtttattgaggatatgaagatgcggtatccc
gtgcttgaaccactggttttggtccttaaacagttcttaatgcagcggcaattaaatcaa
gtattcaccggtggtttatcatcttacgggcttattttaatgctgattagcttcttgcag
cttcacccatcgtacgattattcatataagggaatcacggaggtgaatatgggcgtatta
ttgcttagttttttgcaactttacgggcaggaattcaactacatgaaaacagctttacgt
attcatagcggtggagcgtatgtttgcaaggatgaaatcttagtacagatgaataggcca
tcaaattcgatgttatgtattgaggatcctttacaaccagggaacgatattggacgttgt
tcgcataatattcaattagtccgacaagcttttgaacatgcctttgccacgttgtgtgct
gtatttgttcgatcacgtgagtactcaacagtatggcgtgcccgttatcacggctcactt
ctctctcttattatgcacatttcgccgcgaatgatccgctatagaaattggttaaaagga
cgtgttctatcagatggcacttcgtctccttcactttctaaggcttctacaccagaaaat
ttttcaccatcacttctgaatacttccttgatttcccacttatcctcgccgaatgtttag

DBGET integrated database retrieval system