KEGG   Loa loa (eye worm): LOAG_05763
Entry
LOAG_05763        CDS       T02664                                 

Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm6
  KO
K12625  U6 snRNA-associated Sm-like protein LSm6
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
loa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LOAG_05763
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_05763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_05763
   03041 Spliceosome [BR:loa03041]
    LOAG_05763
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_05763
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     LOAG_05763
Spliceosome [BR:loa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    LOAG_05763
SSDB
Motif
Pfam: LSM SM-ATX LSM14
Other DBs
NCBI-GeneID: 9943172
NCBI-ProteinID: XP_020302756
AA seq 77 aa
MSRRQNPSEFLKQIIGKPVVVKLNSGVDYRGILSCLDGFMNIALEQTEEYSNGQLKNKYG
DAFIRGNNVLYISTQKR
NT seq 234 nt   +upstreamnt  +downstreamnt
atgagtcgacgtcaaaatccaagtgaatttttgaaacaaataattggtaaacctgttgtt
gtgaagttaaattctggtgttgattatcgaggtattttatcatgtttggatggttttatg
aatattgcattggagcaaacggaagaatattctaatggacagttgaaaaacaaatatggt
gatgcatttattcgaggaaataatgtactttatatcagtacacaaaagcgttaa

DBGET integrated database retrieval system