KEGG   Loa loa (eye worm): LOAG_06065
Entry
LOAG_06065        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_06065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_06065
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_06065
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     LOAG_06065
SSDB
Motif
Pfam: PAT1 DUF1819 DUF777
Other DBs
NCBI-GeneID: 9943474
NCBI-ProteinID: XP_003141649
UniProt: A0A1I7W4V0
AA seq 769 aa
MSRIDLKGFGGRCLPNDFDDFNFDVLPEVDDFDSEQPNDNIDAINDETFGVDVDDDTLDD
DLEQYSKQTAGLQLDDEMPKWFDEPTCSVSAPHPSELPTPPFGFNSFPTTNISSYHSKNF
EDFNMQLGTTDALWKNTDSTTSLFGWSGPELSILQHCSANDFINKTIPDRTRFLAVKNNI
SSEEYSDKKDGIRSLAELPKDALTLEEVERNHVTSTSKPSDLTVPPLPPAGALTLGELEK
RFLMQSAGHVTASVPDVGRSTGVLPPDSRIPSMIPPPPLPPPLQCLPFPMLSPFAMQIAR
AHLLGQLPELPPGFPPITPQMRAAILSLGPPPMMRMPSHPMLPPFPFVQQPSHPVSGRPA
LPSYLPCPPQSQMQSHMPQVFHHKMSYSRDRSSKLTGLVSNKTISDFALSPFAGFVSKKE
RSWLIKIQQLQCQGCGNPYEDDFYYTTWKQRKMALEGHGRELKAEDEELGYVWDTTNPHH
YHYYVPPTFAGSLGKPTLSTINYPRQLIDLSSDSPNDDDKLSVKSSTSQKKLRALLLQLE
NVALLIIECDDRHRILCTASLSYEIQEEMKRGVESRMKTIIDTLCLNGRLQAVLLINKGR
QMFARTLSLANEQQQLHLLTNFFVALSTVVKKVSSDEMNESVLVPIFETFSHFSKNALTS
FINNLKLNFANDITMNVFATNLLISLLVCCSRQDCPLDTYFCSTTLSSLIRPWSQEVKCS
LEQCIVLTLADVKILDAWSARNITGYHGSAAEKLIQNLQLTCMLQGSNN
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtcacgaatcgatttgaaaggttttggtggaagatgtctaccaaacgattttgatgat
ttcaattttgatgttttgccggaagtggatgattttgatagtgaacagccaaatgacaac
atcgatgcaatcaatgatgaaacttttggagtggatgtcgatgatgacaccttggatgac
gacctggaacagtattcgaaacagacagcgggtttgcaactggatgatgaaatgccgaaa
tggtttgatgaacccacttgttcggtatccgccccacatccatctgaattaccaacacct
ccatttggatttaattcatttcccacaacgaatatatcttcatatcactccaaaaatttc
gaagatttcaatatgcaactcgggacgaccgatgcattatggaaaaacactgattctaca
acatcattgttcggttggagtggtccagaactttccattctgcaacattgttctgcaaat
gacttcataaataaaacaattccagatcgaactaggtttctagcggtgaagaataatata
tcatcggaagaatattctgataaaaaagatggtatccgatcactggcagagttaccgaag
gatgcgcttactcttgaagaagtggaaagaaaccacgtcaccagtacttctaaaccatca
gatctaacagtcccacctttaccaccagcaggtgccttaacactgggcgagttagaaaaa
cgtttcctaatgcaatcagcaggccatgtaacagcttctgttcccgatgtcggtcgatct
actggtgttttgccaccagattcacgaattccatcaatgatccctcctccaccactaccg
cctccacttcagtgtttaccttttccgatgttatctccttttgccatgcaaattgcaaga
gctcatctgctcggtcaactaccagaattgcctcctggttttcctccgataacaccacag
atgcgagcagcgatcctttcactaggaccaccacctatgatgcgaatgccttcacatccc
atgcttccgccatttccttttgtgcagcaaccttctcatccagtatcaggtcgaccagca
ctaccctcatatttgccttgtcctccgcaatctcagatgcaatcacatatgcctcaggtg
ttccaccacaaaatgagttacagtcgagaccgttcgagcaagcttaccggtttggtatcc
aataaaacaatttctgactttgcattgtctcctttcgctggcttcgtttcgaaaaaagag
cgcagttggctcatcaaaattcagcagctgcagtgtcaaggatgcggtaatccatacgag
gatgatttttattacacgacatggaaacaacggaaaatggcgttggaggggcacgggaga
gaattgaaagcggaggatgaagagcttggttacgtgtgggacactacaaacccgcatcat
tatcattattatgttccgccaacatttgctggtagtttgggaaagccaacactttccact
attaattatccgagacagcttattgatctgtcaagcgattcaccgaatgatgatgacaag
ctttcagtaaagagtagcacatcacagaaaaagctgcgagcacttctcttgcagctggaa
aatgtcgcgttattaattatcgagtgtgacgacagacatcgaatactgtgtactgcttca
ctttcctatgaaattcaggaggagatgaagcgtggtgttgaaagtcgtatgaaaaccata
atcgacactctgtgtttgaacggacgacttcaagctgttttgctaattaataaagggcgt
caaatgtttgcacgaacattatcacttgctaatgaacaacagcagttacatcttcttaca
aatttctttgttgctttatcaactgttgtcaaaaaggtttcatcagatgagatgaatgaa
tcagtgcttgtgccaatattcgagacattttctcacttttcaaaaaatgcactcaccagt
ttcattaataacttgaaactgaatttcgccaatgatataactatgaacgtgtttgcaaca
aatctgttgatatcattattggtttgctgttcacgccaagattgtcctttggatacgtat
ttctgctctactactctgtcttccctaattagaccatggtcacaggaagttaaatgttct
ttggaacagtgcattgttttgacgttagctgatgtcaaaatacttgatgcctggtcagct
agaaatattactggttatcatggatcagctgctgaaaaacttattcaaaatttgcagctt
acctgtatgcttcagggatcgaataattga

DBGET integrated database retrieval system