KEGG   Loa loa (eye worm): LOAG_06254
Entry
LOAG_06254        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04194  cholecystokinin A receptor
Organism
loa  Loa loa (eye worm)
Pathway
loa04020  Calcium signaling pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    LOAG_06254
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_06254
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_06254
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Peptide
   Cholecystokinin
    LOAG_06254
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1980
Other DBs
NCBI-GeneID: 9943670
NCBI-ProteinID: XP_020302632
AA seq 474 aa
MEVIVQDDCRFRPTLENYITIVSFCIIFFLSVVGNAVVVAVILQQRSMRSVTNIYLLNLA
ISDLMLSVVCMPPTLVSSVIYCWIFGDLLCKLFAYLQPVVVTASAYTLAVIAFERYYAIC
KPLHSRIWHTRSHAYTMIALVWLISVLANLLMLFMFELQTYNVNGLTCAPKHRPILHFGY
QIYMTSVLLLIPLCIMIVLYGSVIHALRVDMKVDHTFAATTNSSAMTGNDEQQRLRKYTV
SDSLKMMKSGSGKNINLAASKKFNCFSCFYTSMKQIRTTSDTTSLTNTRKDKSIDLSSKS
SLRSTHSERSVLAKQRVIKMLIVIVIIFFCCWTPNYMWWLLLTAQDSFKTFDIWNSEVNT
AITVLCYISSCANPITYCFLNRKFRTALLVTFGCLRKTPNHFSTVYLPELPMDTLTSKKS
NEEMIALRTERTNRNNQWSMNVIHSQTVLHRTGPTTATIAMTTGHQERKRPVLG
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggaagttatagtgcaggatgattgcagattcagacctacacttgaaaattatatcaca
atagtttcattttgcatcatttttttcctctccgttgttggcaatgctgtcgttgttgct
gtcattttgcagcaacgttcaatgcgatcagtgacaaatatttacttgttaaatttggca
atatcagatttgatgttatcagtggtctgtatgccacctactcttgttagttccgttatt
tattgctggatatttggtgatctcctttgcaagttatttgcatacttgcaaccagttgtt
gtgacagcatcagcttatacattagctgtgatagcatttgaacgatattatgccatttgt
aaaccattgcattcgagaatttggcatactcgatcacatgcctatacaatgatcgcttta
gtttggcttatttcggttcttgccaatttacttatgctttttatgttcgaactacaaacc
tacaatgttaatggtctaacatgtgcacccaaacatcgacccattcttcatttcggttac
caaatatacatgacctcagtgttattgcttattccattatgcataatgattgttttgtat
ggatcagtgatacatgcacttagggttgacatgaaggtggatcatactttcgctgcaaca
actaatagcagtgctatgacaggcaacgatgaacaacaacgactacgcaagtatacggta
tcggatagcttgaaaatgatgaaaagtgggagtgggaaaaatataaatttggctgcatca
aagaagttcaattgcttcagttgcttttatacttctatgaaacaaatacgaactacttcc
gatacaacatcattaaccaatacaaggaaagataaatcgatcgatttaagtagcaaaagt
agcctgcgatcaacacacagtgaacggtcagttttggccaaacaacgtgtcatcaaaatg
ctcatcgttattgttatcatatttttttgctgttggacaccaaattatatgtggtggctg
ttgttaacagcccaggattcatttaagacttttgatatttggaactcagaagtgaacaca
gcaataacagtactctgttacatatcctcgtgcgctaatccaatcacctattgtttcctt
aataggaaatttcgtactgcactcctagttacatttggttgtctacggaaaactccgaac
catttctcgactgtctatttacccgaattaccgatggatacattgacatcaaagaaatca
aacgaagaaatgatcgctctccggacagaaaggacgaatcgaaataatcaatggtcaatg
aatgttatccactctcaaacagtacttcatcgtacaggtccaactactgcaacgatagca
atgacaacaggacaccaagaaaggaagaggccagtactgggatag

DBGET integrated database retrieval system