KEGG   Loa loa (eye worm): LOAG_06429
Entry
LOAG_06429        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12598  ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_06429
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_06429
   03041 Spliceosome [BR:loa03041]
    LOAG_06429
   03009 Ribosome biogenesis [BR:loa03009]
    LOAG_06429
   03016 Transfer RNA biogenesis [BR:loa03016]
    LOAG_06429
Enzymes [BR:loa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     LOAG_06429
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     LOAG_06429
Spliceosome [BR:loa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    LOAG_06429
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    LOAG_06429
Ribosome biogenesis [BR:loa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    LOAG_06429
Transfer RNA biogenesis [BR:loa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    LOAG_06429
SSDB
Motif
Pfam: rRNA_proc-arch DSHCT DEAD Helicase_C ResIII UPF0449
Other DBs
NCBI-GeneID: 9943843
NCBI-ProteinID: XP_020302595
AA seq 1008 aa
MDKDMEIFDVFAGSSGSLSSCSTGKKKLSSGSFQKAEMNKKRQMEARERANQLLGQLATG
NAANNIRMVSSDDDDDDDCDHDYEADDNDTGVLSKRSKNETNAEELPGLASHPRNNIKTV
ESEGNCSHEVVLPPNMEYVPLKPRTTAPAKMYEFQLDAFQREAITCIDNSHSVLVSAHTS
AGKTVVALYAIAMSLRDKQRVIYTSPIKALSNQKYRELEEEFGDVGLMTGDNTLNPDASC
IVMTTEILRSMLYRGSEIMREVGWVIFDEIHYMRDKERGVVWEETIILLPDTVHYVFLSA
TIPNARQFADWVVYLHDQPVHVIYTDYRPVPLQHFIYPAGGSGLYEVVNMQGIFREDKFT
EAMNVLSQVGDAGHGGINKGKKGGTSGTPHVVNIIRTLKERDMIPVIIFSFSRKECEAYA
TQMTNLDFNTEDEKAKVKEIFVNAISLLSDEDSKLPEIGRVLPLLLRGIGVHHSGLLPIV
KEVIEILFGEGLIKTLFATETFAMGLNMPARTVLFTSARKFDGKDYRWITSGEYIQMSGR
AGRRGKDDRGLVILMVDQQMGQDVAKQIIKGAPDPLNSQFRLTYNMVLNLLRVEGINPEF
MLENSFYQFQNYDALPQLYGNVERKKEELAAYKIDRETEISGYYQMEKQVDVLKEAVKEV
VMKPKHLIPFLQAGRLLHIVSNDKDFGWAALLDFHKKANPVDPLGLDLMYVLDVLMLLSA
ESAKNLSDITQLRPPNANEKGVVEVVSVAISCVSEISAARVKLPQNLKAYEGKQSAGRVI
KEVLKRFNGIMPLLDPLNDMKINDLVLQENISKLQALEKRKDSHPLRANSKFDEIYKQYE
KKLELEAELKVAKTELKKAQSLLQLDELKCRKRVLRRLQYCDENDVITQKGRVSCEVSAA
DELMLTEMMFGGIFTELATPQLAALLSCFVFEEKAGGTKLADDLSGCLRAMQEYARRIAK
VTKESKLEIDEDKYVESFKPHLMDVVHAWCTGASFAEILKKRMFLKVQ
NT seq 3027 nt   +upstreamnt  +downstreamnt
atggataaagatatggaaatcttcgatgtttttgcaggaagtagtggttcactatcatcc
tgtagtactgggaagaaaaaactatcgagcggatcttttcaaaaggcagagatgaataag
aagagacagatggaagctcgtgaacgagccaaccaattactgggacagttagcgacaggt
aacgctgcaaataatattaggatggtatccagcgatgatgatgatgatgatgattgtgat
catgattatgaggcagatgacaacgatacaggagtgttatcgaaaagatcgaaaaatgag
accaatgcagaagagcttcctggtttagcttcccatccacgcaacaatatcaaaactgtc
gaaagtgaaggaaattgttcacatgaagttgttttgccaccaaatatggaatatgtacca
ttgaagccacgtacaacagctccagccaagatgtatgagttccagttagatgcctttcaa
cgggaagcaatcacgtgtattgacaatagccattccgttcttgtgtctgctcatacttct
gctggaaaaactgttgttgcattatatgcgatagcgatgtctctacgtgataagcagcgc
gttatatatacttcacctatcaaagctttgtctaatcagaaatatcgagaattggaagaa
gaatttggtgacgtaggtttgatgactggtgacaatacactgaatccggatgcttcttgc
attgttatgactacagaaattttgcgatcaatgttatatcgtggttcagagattatgagg
gaagttggatgggttattttcgatgaaattcactatatgcgcgataaagaacgtggcgtt
gtatgggaagaaacaattattttgctacccgacactgtacactatgtttttctttccgct
acgatcccaaatgcaaggcaatttgcagactgggtagtttatcttcacgatcaaccggtt
catgtcatatataccgactaccgtccagtacctttgcaacacttcatatatccagcgggc
ggttcaggcctgtatgaagttgtaaatatgcagggaattttccgagaagataaatttacc
gaagcaatgaatgtattgtcacaagtgggagatgcagggcatggtggaatcaacaaagga
aagaaaggtggaacatcaggcacacctcatgtggtgaatataatacgtacgcttaaggaa
cgtgatatgattccagtcatcattttctcattcagtcgaaaagagtgtgaagcatatgca
acgcaaatgacgaatttggatttcaatacagaagacgaaaaagcgaaggtaaaagaaata
tttgttaatgcaatcagtttattatctgacgaagacagcaaattacctgaaattggacga
gtattaccattattattgcgtggtattggagtgcatcattcgggtttgctgccaattgtt
aaggaagtgatcgagattttattcggagagggtttgatcaaaactctgtttgctactgaa
acttttgccatgggtttaaatatgcctgcgcggacggtgctgttcacatcggcaagaaaa
ttcgatggaaaagattacaggtggattacatcgggtgaatatatccaaatgagtgggcga
gctggacgtcgaggtaaagacgatcgcggccttgtgatactaatggtcgatcagcagatg
ggacaggatgtagctaaacagattattaaaggtgcaccagacccgcttaattcgcagttt
cgtttgacgtataatatggttctgaacttgcttcgagttgaaggcatcaatcctgaattt
atgctggagaattcattttatcagttccagaattatgatgccctaccgcaactctatgga
aacgtggaaagaaagaaggaggaacttgctgcctataaaattgacagagaaacagaaata
tcaggttattatcaaatggaaaaacaggttgatgtattaaaagaagccgtaaaagaggtc
gttatgaagcctaagcatcttataccctttcttcaagctgggcgtttgcttcacattgtt
tcaaacgataaagattttggatgggcggctctgttggacttccacaaaaaagcgaacccg
gttgatcctcttggcttggacttgatgtacgtactagatgtattgatgttactgtctgca
gaaagtgcgaaaaacttgtcagatattacacagttgcgaccacctaatgcgaatgagaag
ggagttgtagaggttgtatctgtcgcgatcagttgtgtatctgaaataagtgcggcacgc
gtaaagttaccgcagaacctgaaagcatatgaaggaaaacaaagtgctggtcgcgttata
aaagaagttttgaaaaggttcaacggaattatgcctttgcttgatccactgaacgatatg
aaaataaatgatttagtgctgcaggaaaatatttctaagttgcaagcactggaaaagaga
aaggatagccatcctttgagggcgaatagtaaatttgacgaaatctacaagcagtatgaa
aagaagctagagttggaagcggaactgaaggtggcaaaaactgagctaaagaaagcgcaa
agtttattgcagctggatgagttgaaatgtcgcaagcgtgtgcttcgaagattgcaatat
tgtgacgaaaatgatgttattacacaaaaggggcgtgtctcgtgtgaagtaagtgctgca
gatgagctgatgttaacggagatgatgtttggtggcatatttaccgagcttgctactccg
caattggcagctttgctttcgtgttttgtatttgaagaaaaagcagggggaacaaaacta
gcagatgatctcagtgggtgtttgagagcaatgcaagaatacgctagacgcattgcgaag
gtgacaaaggaatcaaagcttgagattgatgaagacaaatatgtggagtcgtttaagccg
catttgatggatgtagtccatgcatggtgtactggtgcttcttttgctgaaattttaaaa
aaacggatgtttttgaaggttcaataa

DBGET integrated database retrieval system