KEGG   Loa loa (eye worm): LOAG_06875
Entry
LOAG_06875        CDS       T02664                                 

Name
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
loa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_06875
   03410 Base excision repair
    LOAG_06875
   03420 Nucleotide excision repair
    LOAG_06875
   03430 Mismatch repair
    LOAG_06875
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_06875
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_06875
Enzymes [BR:loa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LOAG_06875
    6.5.1.6  DNA ligase (ATP or NAD+)
     LOAG_06875
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LOAG_06875
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    LOAG_06875
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     LOAG_06875
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LOAG_06875
   NER (nucleotide excision repair)
    Other NER factors
     LOAG_06875
   MMR (mismatch excision repair)
    Other MMR factors
     LOAG_06875
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 9944292
NCBI-ProteinID: XP_020302483
AA seq 665 aa
MQYFHRIGRVVIGCKQIRGMFSELVEAPRNAKDDWKSGEKIPYLCLAKTFEDIEATSSRL
EIIKILANFFGKVIERTPNELAICVYLCVNKLGPTYEGMELGIAEGALMKAIAQATGRKI
DKLREDLNQKGDLGLVAQMSRSNQRILFTPAPLTVTSVFHKLQDMAKTSGHMAMNKKVDM
IKSLLVSCRDCEARYLIRSLSGKLRIGLAEQSILVALANAFTNFEAKKSGEKLNCEKMKE
RQAEDILLLKSTYSECPDYEKVIEAVLSDGLSKLPEKCKITPGIPVKPMLAHPTKGIDEV
LKRFGDSVFACEFKYDGERAQIHYDSSGIKIFSRNQENNTDKYPDVREQLKQIMDEETTS
FIIDSEIVAFDPVHETILPFQILSTRKRKNVGDSEIKVKVHVFIFDLLFWNGQSLTKSPY
RKRREILRQHFKEVGGICGFVASKDTEDTEQISEFLDDAIKGNCEGLMIKTLDCDATYEI
AKRSRSWLKLKKDYLDTIGDTLDLTVIGAFFGTGKRTGVYGGYLLACYNPINEEYESICK
IGTGLTDDDLRQQHQYFEELRIEKARPYYSYDSSLKPDVWFDPKIVWEVKAADLSISPKH
FAARGIVDQEKGISLRFPRYIRMRTDKTPEEATTSQQIADMYNNQEQIKNKGANGANDDN
NDDYY
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgcaatatttccacagaataggacgtgtagtgattggatgtaagcagatacgcgggatg
ttcagtgaattggtagaagcaccacgaaacgccaaggatgattggaaatcaggagaaaaa
ataccatatctttgcttggcaaagacattcgaagacattgaagccacatcatcacggctg
gaaataatcaaaatattggccaatttttttggaaaagtgatagaacgaacgccaaacgaa
ctggcaatatgtgtttatttgtgtgtaaataaacttggcccaacatatgaaggaatggag
ttggggattgctgaaggagctttaatgaaagctatcgcccaggcaactggtcgtaagatt
gataaactgagggaagacttgaatcaaaaaggggatttgggtttggttgcgcagatgagt
cgaagtaatcaacgcattttgttcacaccagctcctcttaccgtaacttcagtttttcat
aaattacaggatatggcaaaaacttccggacatatggcaatgaacaaaaaagtggatatg
atcaaatcactcctggtttcgtgtcgtgactgtgaagctcgttatctgataagaagtctg
agcggaaaactgcgaatcggtttggcagagcagtcaatacttgtagctcttgcaaacgca
ttcactaattttgaagctaaaaaaagtggtgaaaaactgaactgtgaaaaaatgaaagaa
cgacaagccgaggatatcttattgctgaagagtacatacagcgaatgtccagattatgaa
aaagtaattgaagcggtgcttagtgatggtctgtcaaagttgccagaaaaatgcaaaatc
acaccaggtatacctgtaaaaccaatgttagcgcatccgacaaaaggaatcgatgaagta
ctgaaacgtttcggcgattctgtcttcgcttgcgaatttaaatacgacggtgaaagagct
caaatacactatgattcatctggcattaaaatatttagtcgaaatcaagaaaacaatact
gacaaatatccggatgtgagagaacaactaaagcagattatggatgaagaaacgacatct
ttcattattgattcggaaattgttgcatttgatccagtacatgaaacaattttacctttc
cagattctttctacgaggaagaggaagaatgtgggtgatagtgaaattaaagttaaagtc
catgtatttatattcgacctactattttggaacggccaatcactaacgaaatctccatat
cgaaagcgacgagaaatattgcggcaacattttaaggaagtgggaggtatttgtggattt
gttgcgtccaaagatacggaagacacggaacaaatttccgaatttctggatgatgccata
aagggtaactgcgaaggacttatgatcaaaacgcttgattgtgatgctacctatgaaata
gcaaaacggtcacgcagttggctaaagcttaaaaaggattatttggacacaattggagat
acccttgatctcaccgttattggtgcattctttggtacgggtaaaagaacgggtgtctat
ggtggttacctactggcatgctataatccaataaacgaagaatatgaaagtatttgcaag
attggcacaggtttgactgacgatgatcttcgccagcaacaccaatactttgaagaactc
aggatcgaaaaggctcgtccttattattcttacgatagctcgttgaaaccagatgtgtgg
tttgatccgaaaattgtttgggaagtgaaagcagctgatttgtcgatatctcctaaacat
tttgctgccagaggaatcgtagatcaggaaaagggaatttccctgcgatttcctcgatac
attcgaatgcgtactgataaaacaccggaggaagctactacttcacagcagatagcggat
atgtataataatcaagaacagatcaaaaataaaggagcaaatggtgctaatgatgataat
aatgatgattactattga

DBGET integrated database retrieval system