KEGG   Loa loa (eye worm): LOAG_06902
Entry
LOAG_06902        CDS       T02664                                 

Name
(RefSeq) receptor family ligand binding region containing protein
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_06902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_06902
G protein-coupled receptors [BR:loa04030]
 Metabotropic glutamate receptor family
  GABA
   LOAG_06902
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Csm1_N Med9
Other DBs
NCBI-GeneID: 9944318
NCBI-ProteinID: XP_020302478
AA seq 853 aa
MLIWILLIINGCLCAIINCVDLHIGGVFPMEAGSGGWAGGEACLPAVQIALQDVNANTNI
LPGYMLKLHYHNSKCQPGLAAKQLYELLYKAPTKLMLLAGCSPVTTVFAEAAPVWNLVVL
SYGGSSPALSNRQRFPTLFRTHPTANMQNPTRLRLFQKFKWKKITILQSVEEVFTSTAKD
LEEQCREKGIRVERQSFYGDPSDAVKTLVRQDARIIVGLFYVTEARRVLCQAYKHDLYGR
KYVWFFIGWYADTWFIPPTDEPLNCTAEQMIKAAQYHITTESIMLSRDEELTVSGMTGKQ
FQKRLMNMLTTDPAETGGFPEAPLAYDAVWAVALAFNCTLSKLQAGQSLENFAYNNTSIA
KKLFNCVKDTQFRGVSGQVMFNDLGDRIARTQIEQLQDGKYQMLGIYDTTTLRLDWYGKE
KFSTMNGLPPPDSTLIQEWLLTVDLELYYAIALLAVVGIFVACIIFIFNIRNSDRMIIME
SQPQCNNVLLAGCILCCLSLLLLGLPARGITIPKHSFTLLCHSQISLLMVGFTFAYGSMF
AKVWVVHRLGAAENQHLISRPTTGQSVPACKFYLVVTAFFVVDVIIITCWFTFDPIQRVE
QRFPLQEPPMGTEEDVMLLPILELCQSKRQEMWTGLVMGYKCLLLVLGLFLAYETRNLKP
LFVNDLRFVGLAIYNVAVLSLITGPIVTFLIRSQSDANFAFISITVLLSTYITLGLVFLP
KIVHIRRIPKSGEKNDGTKPLYHPDAAGIEQKRCQQLVHENADLKCQIEHKEKKIADYRQ
RLRKHIQETTGIPLRERIYISTSDENITHSFPTALTTTALIENLPSENTDKYNSNYEEVE
NEDTSSTFSELFL
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgttgatttggatattgctgattattaatggctgcttatgcgcaattattaattgtgtg
gacttgcatattggaggcgtttttccgatggaagcaggctcgggtggatgggcgggtggt
gaagcgtgtctaccggccgtacagatcgcccttcaggatgtaaatgccaataccaatatt
ttaccgggttatatgttgaagttgcattatcataatagtaagtgtcaaccgggtctagca
gcaaagcaactgtacgaattgctgtataaggctccaacaaaactgatgttgctagctggt
tgtagccctgtgacaactgtttttgcggaagcagctccagtctggaatctcgttgtgctt
tcttatggtggcagttctccagcgctttccaacagacagcgctttccgacactttttaga
actcatcctaccgcaaatatgcaaaatccaacaaggctaagacttttccaaaaatttaag
tggaagaaaataacgattttacaatcagttgaagaagtattcacgtcaacagccaaagat
cttgaagagcaatgtagggaaaagggtattcgagttgaacggcaaagcttttacggtgat
ccttcggatgctgtaaaaaccttggtacgtcaagatgctcggattattgttggtttgttc
tacgttactgaggctcgacgcgtactttgtcaggcttataagcatgatctctatggtaga
aagtacgtttggtttttcattggttggtatgctgatacgtggttcattccaccgactgat
gagccacttaactgcactgccgaacaaatgattaaagcagcacagtatcatataacaacg
gaaagtataatgttaagtagagacgaagaattgacagtttccggaatgactggtaagcag
ttccagaaacgattgatgaatatgctgaccactgatccagctgaaactggtggttttcca
gaagctcccctagcctatgatgctgtctgggcagttgcattggctttcaactgcacacta
tcaaaacttcaagcaggacaaagtcttgagaattttgcttataacaatacaagcatagca
aaaaaattattcaactgcgttaaagacacgcaatttcgcggtgtttcaggtcaggttatg
ttcaatgatcttggtgatcgcatcgcacgaacacaaatcgaacagctgcaagatggaaaa
tatcaaatgctgggtatttacgacacaacgacacttcgtctggactggtatggtaaggaa
aagttttcaacaatgaatggattacctcctccggattcgactcttatacaagagtggctc
cttaccgttgatctagagttatattatgcaattgcgttactggcagtggtcggaatcttc
gttgcatgtattatattcatatttaacatcaggaactctgatagaatgataataatggaa
tctcaaccacagtgtaacaatgtacttctagctggatgtatactttgctgcctaagccta
ttgttattgggtctaccagcacgtggaatcactattccaaagcattcattcacactactc
tgtcattcacaaatatcacttttaatggttggtttcacgtttgcttatgggtcgatgttt
gccaaagtttgggttgttcatcggttaggcgcagcagagaatcagcatctcatctccagg
ccaactacaggacagtcagtgcctgcatgcaaattctacctcgtagttactgcatttttt
gtggtcgatgtaatcataataacttgttggtttacatttgacccgattcaaagggtcgaa
caacggtttccactacaagagccaccaatgggaactgaagaagatgttatgcttttaccg
atccttgaactgtgtcaaagtaaacgacaagaaatgtggacaggcttggtaatgggttat
aaatgtttgctattggtgctcggtcttttcctcgcatatgaaacgcgtaatttaaaacct
ctttttgtgaacgatctacgcttcgttggtttggctatatataacgtcgccgtgttatca
ctaataactggaccaattgtcacttttcttattcgatctcaatccgatgccaattttgct
tttattagcattactgttttattgagtacatatataacgcttggtctagtatttttgcca
aaaattgttcatatacgtcgaatacctaaaagtggggagaaaaacgatggtactaaacca
ctgtatcatccagatgctgctggaatagagcaaaaaaggtgtcaacagcttgttcatgag
aatgccgatctgaagtgccaaatagagcataaggagaaaaaaatcgcggattatcgtcag
cgtttgcggaaacatattcaagaaacaactggtattccacttcgtgaacgtatatatatc
agcaccagcgatgagaatataacacattcatttccaactgcactcacaacaactgctttg
atcgaaaatttgccaagcgaaaatacggataaatacaacagtaattatgaagaggtggaa
aacgaagatacatcgtcaacattcagcgaattatttctgtag

KEGG   Loa loa (eye worm): LOAG_07586
Entry
LOAG_07586        CDS       T02664                                 

Name
(RefSeq) metabotropic GABA-B receptor subtype 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_07586
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_07586
G protein-coupled receptors [BR:loa04030]
 Metabotropic glutamate receptor family
  GABA
   LOAG_07586
SSDB
Motif
Pfam: 7tm_3 ANF_receptor DUF2976
Other DBs
NCBI-GeneID: 9945009
NCBI-ProteinID: XP_003143169
UniProt: A0A1S0TVQ6
AA seq 801 aa
MAQIWFGYTHDCQKLRRINRIPLTIGVFLPYQYKRVLELAVNTALEHIHNQSCILNDYYL
NLHFKDTECKTSFGMKALFELMNAHPRPFALFGDACTNVNEVVAMASKYWHILHLSYAEI
HAKFATADAQAMYPTFFRMVPGYQNSNLARCHLIYQFNWTRVGTLKQSDDPRFALPHESL
TTRLEHGFGVRVIYTAGITHDEIQNIGYELNELKKRDARIFIGDFEESLAVRILCEAYQN
GIYGENYAWILPGYHKNDWWHNVSGVNCTVEELAQVIEGHFAVEFSPYSQRLARLTIANK
TVSAIRTELDAREGSSPESVFKGYVYDGLWTLALAIEHVAELHQQREGITWMPNVSDTKE
WTKFSAELLQAISRTSFIGVTGPVQFENNERLGLVEILQWRNGSYLIAGIYDGTEAVLVL
NPALKDWIPPLDATIVVRERQYISFVLLILLSLLATIGVAVAVFFLIINIRYQNHRYIKM
SSPNMNNLIIAGSICTYISVILLGFDTRFVSPDTFVTLCYVKTWVLSLGFTLAFGSMFSK
TWRVHLIFKNIRMNKKAIKDYKLFILVGFIVLVDLISLTLWARISPFTFHVNQLAIFYSD
NKMIAPEIEHCQSDNSVIFEAIILGIKGLLMLLGCFLAWETRRVNVPALNDSKYIGMSVY
SVVVTCLLGLPLVYILKDRINEAHILGSLFIIFCTTLILCLVFVPKFTTIFTFPIVELFR
NPQGTELRYRRGLVKSSLRRSESQRDSQYKDREHLQRLEEENILLHRYLLQKTSILWELK
EQLRQLGEQEDDIVTPPSDKS
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggcgcaaatatggtttggctatacccatgactgccagaaattacgtcgcataaatcga
ataccattaacaatcggcgtcttcttgccatatcaatacaagcgggtattggaacttgct
gttaataccgctctggaacatattcacaatcaatcttgtattctaaacgattactatttg
aatttacacttcaaggatactgagtgcaaaacatcatttggaatgaaagcactgttcgag
ctgatgaatgcacatccacgaccttttgcactttttggtgatgcatgcacgaatgttaac
gaagttgttgctatggcatctaagtattggcatattttacatttgtcatatgctgaaata
catgcaaaatttgccaccgcggatgctcaggcgatgtatccaacattttttcgtatggtg
cccggatatcagaattcaaatttagcacgatgtcatctaatttatcaatttaattggact
cgtgttggtacactgaaacaaagcgatgatccacgttttgcactaccacatgaatcacta
acaacacgactggaacacggatttggtgttcgagtgatatatactgctggtatcacacat
gatgaaattcaaaatatcggttatgaacttaatgaattaaagaaacgtgacgctcgaatt
ttcatcggtgattttgaggaatcattagctgtacgaatattatgtgaagcttaccaaaat
ggtatttatggtgaaaattatgcatggattctacctggctatcataaaaatgattggtgg
cataatgtatccggggtcaattgtacagtagaagagctagcgcaagtaatcgaaggtcat
tttgcagtagaattttcaccatattcgcaaaggcttgctcgacttaccattgccaataaa
acggtatcagcaattcggacggagcttgatgctagagaaggttcatcaccggaaagtgtt
ttcaaaggatatgtgtacgatggcctctggacacttgctttggctattgaacatgtagca
gaacttcatcaacaacgtgaaggaattacttggatgccaaacgtgagcgatacaaaggag
tggactaaattcagtgccgaattacttcaagctatcagcagaacttcatttattggtgtc
actggaccagttcaatttgaaaataatgaacgacttggattagttgaaattttgcaatgg
agaaatggttcgtatctaattgctggcatatatgatggtacagaagctgtccttgtcctc
aatcctgctcttaaagattggataccaccattagatgcaacaattgttgtacgtgaacgt
caatatatatcattcgtattactcattcttctctcattacttgccactatcggtgtagca
gtagcagttttcttccttatcattaatatcagatatcaaaaccatcggtatattaagatg
tcatcaccaaatatgaacaatttaatcatagcaggttccatttgcacttatatcagtgta
atcctccttggtttcgatacacgtttcgtttcaccggatacttttgttacactctgttat
gtaaaaacatgggtactaagccttggtttcactctagcatttggatcgatgttctcaaaa
acttggcgagttcatttaatttttaaaaatattcgaatgaacaagaaagcaatcaaagat
tacaaattattcatactggtcggcttcattgttctcgttgatttaatttcattaacctta
tgggctcgcatttcacctttcacatttcacgtcaaccaattagctatattttattcagat
aacaaaatgatagcaccagaaatcgaacattgtcaaagtgataatagcgttatttttgaa
gctatcatattgggtatcaaaggccttcttatgctacttggctgttttcttgcttgggaa
acgagacgtgtaaatgtcccagcattaaacgacagtaaatatataggaatgtctgtttat
agtgttgtcgtaacatgtttacttggtcttccacttgtatacatattgaaggatcgaata
aatgaagcgcatatattgggaagtctttttattatattttgtacaactctaattctttgc
cttgtttttgtcccaaagtttacaacaatatttacatttccgattgtggaactttttcga
aatcctcaaggcactgagttacgttatcgacgtggtttagtgaaatcttctcttagacga
tcggaatcacaacgagattcacaatacaaagatcgagagcacttgcaacgtttggaagaa
gagaacatattgttacatcgatatttacttcagaagactagtatactgtgggagttgaaa
gagcagttaagacaacttggagagcaagaggatgacatagttacgccgccaagtgacaag
agttaa

DBGET integrated database retrieval system