KEGG   Loa loa (eye worm): LOAG_06972
Entry
LOAG_06972        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_06972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_06972
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    LOAG_06972
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 9944391
NCBI-ProteinID: XP_020302450
AA seq 412 aa
MMESNLTRNAISFGTSAFDEAMRNLTEVMDAGNGVKMATIGALLVVLIMACIIGNLFVIV
AILIERDLKTRPQYYLIFSLAVADLLVGVIVTPLGAWSTIMSAWTFGVVLCDFWISIDVL
VCTSSILHLVAIALDRYWSVTDVSYVQNRTPNRIFGMLGIIWLVSLLISLAPMFGWKDSD
FYRRVMEQRVCLISQQISYQIFSTATAFYIPLCAIISIYYKIMRTAKSRFKRERERRKTT
NYSHQNAKYQKQCGKHLKSNSSTINENEKIPISTKSTIEEELPCDTVETPLDQCNLQLMN
GKNGKKKMNVSIRKRKGCIKENAEMKREHKAWRTLAIITGTFVACWTPFFLISLYRPICR
CEIPILVESITNWLGYLNSALNPIIYTVFSNDFRTAFKRILARLLFLKMARP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgatggaatcaaatttaacaagaaatgctatttcatttggtacttctgcgttcgatgaa
gcaatgagaaatttaacggaagtaatggatgcagggaatggagtgaagatggcaacaatt
ggagcacttttagttgtacttattatggcatgtattattggtaatttatttgttattgtt
gcaattcttatcgaacgtgatctcaaaactcgacctcaatactatcttatattttcgctt
gctgttgctgatttattagtaggtgtaatagtgacaccattaggtgcttggtcaacaata
atgagtgcatggacatttggtgtagtattatgtgatttttggattagcattgatgtatta
gtctgtacaagctcaatccttcatttagttgcaatcgcattggatcgttattggagtgtc
accgatgtgtcatatgtgcaaaatcgtacaccaaatcgaatatttggcatgttaggtatt
atttggctcgtatcattactcatttcattggctccaatgtttggttggaaagatagtgat
ttttatcgacgggttatggaacaacgtgtgtgcctcattagtcaacaaataagttatcag
atatttagcacggcaactgctttttacattccattatgtgctattatatccatctattat
aaaattatgcgtactgcaaaaagtcgttttaaacgtgaacgtgaacgtcgtaaaactacc
aattattcacatcagaatgcaaagtaccaaaaacaatgtggaaagcatttgaagtcaaat
tcaagtacgattaatgaaaatgaaaagattccaatcagtactaaatcaacaattgaagaa
gaattgccatgtgatacagttgaaactcctttggatcaatgcaatttacaactaatgaat
ggtaaaaatggaaagaaaaaaatgaatgtttcaataaggaaacgaaaaggatgcattaaa
gagaatgctgaaatgaaacgtgaacataaagcatggcgtacacttgctattattactgga
acatttgtagcatgttggacaccattttttctcatttctctttatcgaccgatatgtcgt
tgcgaaataccaatattggtggaatcaattactaattggttaggttatttgaattcagca
cttaatccgattatctataccgtattttctaatgattttcgaacagcttttaaacgtatc
cttgctcgattgctatttcttaaaatggcacgaccatag

DBGET integrated database retrieval system