KEGG   Loa loa (eye worm): LOAG_07104
Entry
LOAG_07104        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K03678  exosome complex component RRP45
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_07104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_07104
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_07104
SSDB
Motif
Pfam: RNase_PH Prefoldin RNase_PH_C
Other DBs
NCBI-GeneID: 9944519
NCBI-ProteinID: XP_003142686
UniProt: A0A1S0TX99
AA seq 521 aa
MEVANEKQAIPIADLGVDQLTYFQRQLDQEIAFLTESLKELKIFESKFIASEESVMNAAK
VPSDGEILVPLTESMYIPAKIADPKNHLIEIGTGYFVEMSTEKAVDYFRRKQAFLKQQME
VIEGVLPEKYRARNAIVDNLQKKINVYCSQRIDGRKCDEFREVKVIVGSELGSCLVMLGE
TKVLAQVSCSLVEPSTVRGNMGTVEVHVDMSPMASPDYEDGRLGSKGLELMRILELLYRN
SGVIDLESLCLRTFKQVWQIRIDVHVLASDGSLVDCACIASLTALAHFRRPDVSVLPDSI
IIASHGNDEKMPISLNIYHMPVCITFGITSDGQNIIDPTDKEEQCLRGSLIVATNKRHEI
CALHQSGNFLLSEQLIVQCVDRAIQRAVDVSELIYSVIADDNLKRSNRQQINGFSELISL
NVLTSHHCEPNELIAPAVKIDALESIPNIEETVTVGDNQMQIGSDNKTVRQMDDEDVKLM
EQVQSIVSLEESRGQENENSQDLEEVDELLQGIEEEFGLRD
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggaggtagcgaatgagaaacaagctattccaattgctgatttaggtgtcgatcaactt
acttattttcagcgacaacttgaccaagaaattgcattcctcaccgaatccttaaaagaa
ctgaagattttcgaatcgaaatttatcgcaagtgaagaatcagtgatgaatgcagccaaa
gttcctagtgatggagaaattttggtgccattaacggagtcgatgtatattcctgcaaaa
atagctgatccaaagaatcatctgattgaaattggtacaggatatttcgtggagatgagc
actgaaaaagcagtggattactttagacggaagcaagcattcttaaaacagcagatggaa
gtgatagagggagtcttacccgagaaatatcgagctagaaatgccattgttgacaatttg
cagaagaaaataaatgtatattgttctcagcgaattgatggacgcaaatgtgatgaattt
cgagaagtgaaagttatcgttggttctgagcttggtagttgtcttgttatgcttggagaa
acgaaagttttggcacaagtgagttgttcacttgtggaaccttcaactgttagaggtaat
atgggcacggttgaagtacatgtagatatgtcacctatggcctctcctgactatgaagat
ggtcgtctcggttcaaaaggtcttgaactaatgcgaatccttgaattgttatatcgtaac
tctggtgttattgacctcgaatcgctgtgcttaaggacatttaagcaggtctggcagata
cgaattgatgttcatgtattggcttcagatgggtcgttagtggactgtgcctgtatcgca
tccttaactgctcttgcccattttcgaagacccgatgtttctgtgcttcctgattccatc
atcattgcaagccacggtaatgacgagaaaatgccgatatcgctcaatatctatcacatg
ccggtttgtataacatttggaatcacttcagacggccaaaatataattgatccgactgat
aaagaggaacaatgtctaagagggtcgcttattgtggctacaaataaaaggcatgaaatt
tgtgcattgcatcagtcaggaaatttcctgcttagtgagcagttgattgtgcagtgtgtt
gatcgagcaatacaaagagctgttgatgtatcagagttgatatattcggttatagcggat
gataatttgaaaagatcgaatcgacagcaaataaatggatttagcgaacttataagctta
aatgtgcttacatcacatcactgcgaacccaatgaacttattgctcctgcagtgaaaatt
gatgcactagaaagtattcctaacatagaagaaaccgtcacagttggtgacaaccagatg
caaatcggtagtgacaataaaacggtaagacaaatggatgatgaagatgttaagcttatg
gaacaagtccaaagtatcgtatccttagaagaatcaaggggacaagaaaatgagaattca
caagatctggaagaggttgatgagcttttacaaggcattgaagaagaatttggattacgt
gactga

DBGET integrated database retrieval system