KEGG   Loa loa (eye worm): LOAG_07386
Entry
LOAG_07386        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12611  mRNA-decapping enzyme 1B [EC:3.-.-.-]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_07386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_07386
Enzymes [BR:loa01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     LOAG_07386
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_07386
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     LOAG_07386
SSDB
Motif
Pfam: DCP1 mRNA_decap_C
Other DBs
NCBI-GeneID: 9944804
NCBI-ProteinID: XP_020302355
AA seq 340 aa
MLVQENMGDAMLVKKRPVSIDEMNLKSIQRLDPCAVAIIDKSVHAALYQFDKCKTQWVKS
AIEGPLFLYKRADKPFHSLMIANRQSLEDHIEPITPPLRFFLEAPYLFMNTQEGDIRGFW
FFEEEDCIRLYKLLVKLVSESNSSTSTIMNDSKRAMSTNSQNGYGAHAGSAAGRDSRCKK
LDEMPALLQQLLSKQSTTKLPDVPTRGALSADQIERQLLLRGAQGESAVVSTGNRREKMM
GKCAPAIGEIEENDTLSDLVSNLSLCAAKTSSNLKDVEKHRSKGKNKYDGAPEDGSSQVV
SLTKDQLLVALKHLLKDDGFVTRLHRAYLESINTRLGLRD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgctggttcaggaaaatatgggcgacgccatgcttgttaaaaagagaccagtttcaatc
gatgaaatgaatcttaaatctatacaacggctggatccatgtgcggtagcaatcattgac
aagtcagtgcatgcggcgctctaccaattcgataaatgtaaaacgcagtgggtgaagtcc
gcgatcgaaggtccattatttttgtacaaacgagctgataagccttttcattcattaatg
attgcaaatcgtcaatctctggaggatcatatcgaaccgatcacacctccattacgattc
tttcttgaagctccatatttgtttatgaatactcaagaaggtgacataaggggtttctgg
ttctttgaagaagaggattgtatacgtttgtacaaattgcttgtcaagcttgtatctgaa
tcaaattcatcgacatctaccataatgaacgattcaaaaagagcaatgtcaactaattcg
caaaatggatatggtgcgcacgcaggtagtgctgcaggacgagacagtcgctgtaaaaaa
ctggatgagatgccggctttgctacagcagttactttcgaagcagtcaactactaaatta
ccggatgtgccgactagaggtgctttgagcgcagatcagattgaaagacagcttcttctc
cgaggtgctcagggcgaaagtgccgtggtgtcgacaggaaacagacgtgagaaaatgatg
gggaagtgcgcgcctgccattggggagatcgaagaaaatgatacattatcggatctagtc
agtaatctgtctctctgtgctgcgaagacatcttccaatctgaaagatgtggagaagcat
cgatcgaagggtaagaacaagtacgatggagcgcctgaggatggtagttcacaggttgtt
tctcttacaaaggatcagttattggtggcactaaaacatttattaaaggacgatggcttt
gtaacacgtttacaccgtgcatatttggagagcatcaatactcggctggggttgcgcgac
taa

DBGET integrated database retrieval system