KEGG   Loa loa (eye worm): LOAG_07544
Entry
LOAG_07544        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04604  metabotropic glutamate receptor 5
Organism
loa  Loa loa (eye worm)
Pathway
loa04020  Calcium signaling pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    LOAG_07544
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_07544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_07544
G protein-coupled receptors [BR:loa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   LOAG_07544
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 9944964
NCBI-ProteinID: XP_020302304
AA seq 1038 aa
MLYSHVTLLMLRVVDVVAKRTVQQTARMLVAEIPGDVQIGALFPLHYQITGTEACGRIWE
QYGIQRMEIALSTVAELNALLPFKLGISIRDSCWTDRIAMEQSIAFLREGVGQCSCTSTP
GCQKKTAPVVAIVGPAKSSTTIAVQNLLQVFHIPQIGYGATTADLSDKEQYGYFMRVVPA
DTWQAKLVVAMLEHFNWTYVAVVYSAGNYGEKGFEELERMINSDQSENVCIAYSEKVKSL
AEPAEFDKILNSLSSQKSVPQVVVCFCEGLTMRGMFKAQQRLRKKNPEMRPFQWICSDGW
NDRLDVVNGVELEAAGSFSIRIHSPHVKWFDQYYFSLNPENNILNPWFREFWQEKFNCQF
AVPKDDLETKICTGRENLTLNYKQDAKLSQVVNSIRVVGLALQTLYNDRCRENSTMCTEI
FALNGTLLLKYMLNVTFVDQFNQEVYFDANGDPPAWYDVLNYVGGEEGFRMVGEYRKKRL
GKYRLKITKDNIMFYDKTNQIPESVCSKPCKIGQRQRETAACCWICEDCLAYQIINYTTR
VCQNCTLGWWPNGDHTTCHPLVHEGPDWSSTGIILALLLASLGILMTLFTVLIFIRYNHT
PVVKSTTRELSYIILNGITICYAVSFAVLARPSFVTCFISRTLPPVGFSMIYSALLTKTN
RIARILAGSKKRILTKKPRFLSTASQVVITWILVCIECVIIAAGVMGEMPQAGFDPYYQP
RRMVLVCSTTTFAFLMPFFWNLFLISLCTLYAVKTRNLPENFNEAKFIGFTMYCTLVVWS
AFIVLHLGTTNKALTMSFSFSLSASIALVLLFFPKLYIILLHPEKNVRASYTTTKLIRCH
FGNSQTTERASKETNNWKSGSSQRSISISRSEAGSQRRYGYRKRKLSVHVSQSPSQDAST
QTESNKITSKFARTFSIISSGLGTAGTSGAEHGIKQFEVNDDVQQLIDSCRRYQISQDER
LHGSVRNLLLMKKEEENENIGYLIADSMKTVLNTVSKQVLPTTSALSHTQISNEDSKFEQ
LLKSRGMEPLQLTNATPL
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgctatacagtcacgtaactctgttaatgcttcgtgttgtcgatgtggttgccaaaaga
acggtccagcaaactgcgcggatgcttgtagccgaaatacccggtgatgtacagattggc
gcactattcccgttgcattatcaaatcacaggtactgaagcatgtggtcgaatctgggaa
cagtacggtatccaacgtatggaaattgcccttagtacggtagccgaactgaatgcattg
ctgcctttcaagcttggtatcagtataagggattcctgctggacggatcgtattgctatg
gagcaatccattgcatttctacgtgaaggcgttggtcagtgctcgtgtacttcaactcca
ggttgccagaaaaagacagctccagtagtggcgattgttggtcctgcaaagagttccact
acaattgcagtacaaaatttgctacaagtatttcatatacctcaaatcggatatggtgca
acaacggctgatctttccgacaaagaacaatacggttatttcatgcgtgtggtacctgcg
gatacgtggcaggctaaactggtagttgccatgttggaacactttaactggacctatgtg
gccgttgtttattccgctggaaactatggtgagaaaggattcgaagagctggaacgaatg
atcaacagcgatcaatcggagaatgtttgcattgcatattcggaaaaagtgaagagtttg
gcggaaccagctgaattcgacaagattttgaattccctaagtagtcaaaagtcggtacca
caagtagtcgtctgtttttgtgaaggtcttacgatgcgtggaatgtttaaagcacagcag
cgtcttcgaaaaaagaatccggaaatgcggccattccagtggatttgtagtgatggttgg
aatgatagattagacgtggtcaatggagtggaacttgaagctgctggaagtttctccatt
aggatacattctccgcacgtaaaatggtttgatcagtattacttctctttaaatccagaa
aataatatactcaatccgtggtttcgagagttttggcaggagaaatttaactgtcaattt
gcggtacccaaagatgatttggaaacaaaaatttgcactggacgggagaatctcacacta
aattataaacaggatgcaaaattgagtcaagttgtaaattcgattcgtgtcgttggatta
gctctccagacattgtacaacgatcgttgtagggaaaattcgacaatgtgcactgaaata
tttgcactgaatggtactttgctgctcaaatacatgctcaatgttacatttgtcgaccag
ttcaatcaagaagtttatttcgatgctaatggtgatccacctgcctggtatgatgttttg
aactatgttggtggtgaggaaggttttcgtatggttggtgaataccggaaaaagcgtctt
gggaagtaccgattaaaaattacaaaggataatatcatgttttatgataaaacaaatcaa
attccagaatcggtttgcagtaaaccttgtaaaatcggacagcgacaaagggaaacagcg
gcttgttgttggatttgtgaagattgcttggcgtatcaaatcatcaactatacaacacgt
gtgtgccagaattgtacgcttggatggtggcctaatggagatcacactacttgccatcca
ttagtacatgaaggaccagattggtcatctacaggtatcatcctcgctttgttacttgca
tccttgggcatattaatgacattattcaccgtattgatattcattcgttataatcatact
cctgtcgtcaaatcaaccaccagagagttatcctatataattctgaatggaattactatt
tgctatgcagtatcattcgctgtacttgcgagaccatcatttgtgacctgctttatatca
cgtacgctacctcctgttggtttttcaatgatttattcagcacttctcaccaagacgaac
cgtattgcccgtattttagcaggaagcaaaaaacgcatcttaacgaaaaaaccacgtttc
ctgagtactgcatcacaagtggtaattacatggatacttgtatgtatcgaatgtgttatt
attgctgctggtgtaatgggggaaatgccgcaggccggttttgatccgtattatcaacct
cgacgtatggtacttgtatgctcaacgacaacatttgcctttttgatgccatttttctgg
aatcttttcttgatatcactttgtacattatatgcggttaaaacgagaaatctaccggaa
aattttaatgaagcgaaatttattggtttcaccatgtattgtactttggtcgtttggtca
gcatttatcgttcttcatttgggtacaacaaataaagcactcactatgagtttttcattc
agtctctcagccagtatagccttggtgttattatttttcccgaaactttatataatctta
ttgcatccggaaaagaatgttcgagcaagttatacaactaccaaattgatacgttgccat
tttggcaattcacaaacgacggaaagagctagtaaagaaacaaataattggaagtccgga
tccagtcaacgctctatttctatttcaaggagcgaagccggatctcagagaagatatggt
taccgaaaacgtaaactatcagttcacgtcagccaaagcccgtcacaagatgcatcgaca
caaactgaatccaacaaaataacttctaagtttgctcgaacattctctattattagtagc
ggtcttggtactgccggtacaagtggtgctgaacatggtatcaagcaatttgaggtaaat
gacgacgtacagcaattaattgattcctgtcgaaggtatcagatttcacaagacgaacgg
ctgcatggctccgtgagaaatttattgttgatgaaaaaggaagaagaaaatgaaaatatt
ggttacttgattgcagattcaatgaaaaccgttctcaatacggtttcaaagcaagtttta
cccacgacttcagcattatcacacactcaaatatccaatgaagacagtaaattcgagcag
ctactgaagagtcgtggtatggaacctttacagttaacaaatgcgacaccattatga

DBGET integrated database retrieval system