KEGG   Loa loa (eye worm): LOAG_07617
Entry
LOAG_07617        CDS       T02664                                 

Name
(RefSeq) DNA-directed DNA polymerase III
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
loa03430  Mismatch repair
loa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_07617
   03410 Base excision repair
    LOAG_07617
   03420 Nucleotide excision repair
    LOAG_07617
   03430 Mismatch repair
    LOAG_07617
   03440 Homologous recombination
    LOAG_07617
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_07617
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_07617
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LOAG_07617
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    LOAG_07617
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      LOAG_07617
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     LOAG_07617
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_A_exo1
Other DBs
NCBI-GeneID: 9945039
NCBI-ProteinID: XP_003143198
UniProt: A0A1I7VCT6
AA seq 1084 aa
MASPIGKRAARSIPSLTKAKRNRPVTDEPSVFVTQLASLAPSDDASGKTAINQFETNRIW
ARPPIPDELHTKPEIDFQVVDVDYYMNSENNVTIRLFGATTNQNSVCVQVHGFLPYFYVL
LEIPFDETHIEYAKKYLNDVIKAQVPANIGIPKNVDNLVVDLDIVYGASIYEYKKDLNQK
FLKVYVCSPKLLNLCRRVFTNGVSLTKGGRTESLSCFETNIDFEIRFMTDHNLVGCAWVT
LPSKKYRIVTGKEMISHCQFECSINNTDLVIHSPESSPRWSSIAPLRILSFDIECTNRQG
IFPEAHTDAVIQIANMVKIEGENEPFIRNCFVIGETAPVIGSQIIVSKSEEELLNKWAEF
VRIVDPDLITGYNIQNFDFPYIVERARALKIESRATMLGRIPSSLSKVREMPLSSKQMGN
RTNKVTNIEGRVVFDVFQVVLRDYKLRSYSLNSVSYHFLCEQKEDVDYAMIADLQNGNAL
TRRRLAIYCMKDAYLPLKLLQKLMSVINYIEMARVTGVPLDYLLSRGQQVKVMSQILRKA
KSMHFFLPVIDVVQPDDTYEGATVIDPIRGFYNTPIATLDFASLYPSIMIAHNLCYTTLI
RRPIASYNLSDSDFEVTPSNNRFVKPNIRHGLLPQVLEDLLNARKQAKNDLKNEQDPFRR
MVLNGRQLALKISANSVYGFTGASVGKLPCLEISQSVTAYGRQMIDLTKNAVEEIYKEGY
LDGKCPCDAQVIYGDTDSVMVKFGVKDVKAAMELGLHAATEVSKKFIPPIKLEFEKVYSP
FLLINKKRYAGLYFTRPEKHDKIDCKGLETVRRDNCPLVSKVLSTCLEKMLLEGDATSAL
EHAKKVISDLLCNRIDISELIITKELTRSSNAYAAKQAHVVLAERMRERDSGSAPRLGDR
VPYVIVAKGQKVPAYEKAEDPIYVLQNNIPIDTAYYLENQLAKPLARIFEPVLGDKAESV
LTTGVHTLVRTVVQSKNSGLSQFFQKTERCLSCKSSLPNGVTDATCTHCKPNEGKVYITH
LALMNAIENRFARLWTECQNCSGTMNEEVLCSSRDCPIFYMREKVRYDLAEQMKSLQRFY
LSTW
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggcatcgccgataggtaagcgtgcagcacgatcaataccatcattgacaaaagcaaaa
cgaaacaggcctgttacggatgagccatcagttttcgtaacacaactggcttcactagca
ccatcagatgatgcttcaggcaaaactgcaattaaccagtttgaaacgaatcgtatttgg
gctcgtccaccaatccctgatgaattacatacaaaaccggaaatcgattttcaagttgtt
gacgtcgattattatatgaatagtgaaaataacgttaccattcgtttattcggagctact
actaatcagaattcagtttgcgtacaagttcatggatttctaccttatttctatgtattg
ctggaaattccgttcgatgaaacgcatatagaatatgcgaagaaatacctaaatgatgtt
attaaggctcaggttcccgctaatattggtatcccgaaaaatgttgataatttagtcgtt
gatctcgatattgtttatggtgccagtatttacgagtataaaaaggatctgaatcagaag
ttcctgaaagtatatgtttgttcgccgaaacttcttaatctctgccgacgagtgtttacc
aatggagtgagcttgaccaaaggagggcggactgagtcattatcatgttttgaaacgaat
atcgacttcgaaattagatttatgacggatcataatttggttggttgcgcctgggttacg
ttgccatcaaaaaagtaccgaattgttacagggaaggaaatgattagtcattgtcaattt
gagtgttcgataaacaatacagacctcgttattcactcgcctgaatcatcgccaagatgg
tcttcaatagcaccattgcgtattctgtcgtttgatatcgaatgcacgaatcgacaagga
atatttccggaagctcacacggatgctgttatacaaatagctaatatggtcaaaattgaa
ggcgagaatgagccatttattcggaattgttttgtaattggtgaaactgctccggtcatt
ggcagtcaaattattgtttctaaatcagaagaagaattgctcaataaatgggcagaattt
gttcgtattgttgatccagatctcattaccggttacaacatccaaaattttgatttccca
tatattgttgaacgtgctcgagcattaaagattgaaagtcgagcaacgatgctaggacgt
attccaagttcactttcaaaggttcgagaaatgcctttatctagtaaacagatgggtaat
agaacgaataaagtaacaaatatcgaaggacgggttgtttttgatgtctttcaagtcgtt
ttgcgagattataaattacggagttattcgctgaacagtgtaagctaccattttttatgt
gaacaaaaggaagatgtggattatgcaatgattgcagacttgcagaatggaaatgctctt
acgcgtcgtcgactagctatttactgtatgaaagatgcctatttgccgctgaagttactt
caaaaattgatgtccgtcattaattatattgagatggcacgtgttactggtgttcctctc
gactatctgctttctagaggtcaacaggtcaaagttatgtcacagatcctacgaaaagca
aagtcgatgcatttctttctaccagtcattgatgtcgtacaacctgatgatacctacgag
ggtgcaacagtaatcgatcctattcgaggtttctacaatactccaattgcaacgcttgat
tttgcatctctgtatccgtccattatgattgcccacaatttatgctataccacattgatt
cgacgtccaattgcatcatataatttgtctgactccgattttgaagttactccgtcaaat
aatcgtttcgtgaagccaaacattcgtcatggcttgttaccacaggttctagaggattta
ctgaatgccagaaaacaagcaaagaatgatctgaagaatgaacaggatccatttcgacgt
atggtattaaatggtcgacaacttgcgctgaaaatatcggcaaactcggtttacggtttt
acgggcgcttcggttgggaagttaccatgtttagaaatctcccaatcagtaacagcttat
ggtcgtcaaatgattgatttaacgaaaaatgcagttgaggagatttacaaagagggttat
ctggatggcaaatgtccgtgcgatgcgcaggttatttacggtgatactgattcagtgatg
gtaaaatttggtgttaaagatgtcaaggcagcgatggaacttggtttgcatgctgctacg
gaagttagcaagaagttcatacctccaattaaattggaatttgaaaaggtttattcaccg
tttttgctgataaacaagaaacgttatgctggtttatattttacgcgccctgaaaagcat
gacaaaattgactgtaaaggattagaaacagttcggcgtgataattgtccgcttgtctca
aaagttttgagtacatgtttagagaaaatgttgttggaaggtgatgctacaagtgctctg
gaacatgctaaaaaggtaatatcggatcttctttgcaatcggattgatatctcagaactc
ataatcaccaaagaactaactcggtcaagtaatgcttatgctgcaaaacaagcccatgtg
gttttagcagaaagaatgcgggagcgcgattccgggtcagcaccgcgtttgggtgaccgc
gtaccatatgttattgttgccaagggccagaaagtcccagcttatgaaaaggccgaagat
cctatatatgtattacaaaacaatatccccattgatacagcctattatttggaaaatcaa
ttggccaaaccgttggctcgtattttcgaacccgttctgggcgataaagctgaatcagtt
ttaacaactggtgtacatacgctggttaggacagtggtgcagtcgaagaattcgggattg
tcgcagtttttccagaaaactgagcggtgcctttcatgcaagagtagcttaccaaatggt
gtaactgatgccacatgcacgcattgcaaaccaaatgaagggaaggtttatattacccac
ttagctctaatgaatgctatagaaaaccgctttgcacggttatggactgaatgtcagaat
tgttctgggacaatgaacgaggaagtgctttgctcttcgagagattgtccaatcttttac
atgcgagaaaaagtacggtatgatcttgcggaacaaatgaaatctcttcagcgattttac
ctttcaacgtggtga

KEGG   Loa loa (eye worm): LOAG_16701
Entry
LOAG_16701        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K02328  DNA polymerase delta subunit 2
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
loa03430  Mismatch repair
loa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_16701
   03410 Base excision repair
    LOAG_16701
   03420 Nucleotide excision repair
    LOAG_16701
   03430 Mismatch repair
    LOAG_16701
   03440 Homologous recombination
    LOAG_16701
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_16701
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_16701
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    LOAG_16701
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      LOAG_16701
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     LOAG_16701
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N NACHT_sigma
Other DBs
NCBI-GeneID: 9949734
NCBI-ProteinID: XP_003147835
AA seq 414 aa
MANGNHVLVNINQSNGNQFLGDDIEPCRLTKAGKDSKVLVIGTIAKRVKLRPSVLRDLAE
EQLILPQPVAEDKLIGEEDFVEFEDDDQIVRLSGDFVMDEFATGCVVGIYGMQFDNDIFQ
VNEVIWPSKAPQPTYPILNDDRYVVFVSGFSFTGQADKDAEKIFSLDLLQKWLCGSLPLF
GKERDVVERVVRLVVAGESVAITEQGREFTTAARYLIKNEECPNVECVAHMDKFLSKISS
LLEVDVMPGLGDPSTYLMPQQPIHRAVFVMGSKHGKMLNLVTNPYQFSLEGVHIVGTSGE
CLSDLKRFTKRLNGIELLSKILDWQHLAPTIPDTVDGFPFMDRDPFIIESFPHILFAANQ
PEASHALVEFEGNRRTLLLSIPSFTKTLSVVLVNLRNLEVVEHSFAVDRLVCNT
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcaaatggcaaccatgttttggttaacattaaccaaagtaatggtaaccaattttta
ggtgatgacattgaaccatgtcggcttacaaaagctggaaaagattctaaggttttggtt
attggtacaatagcaaaacgtgttaaattaaggccaagcgtccttcgtgaccttgcggag
gagcagctcattcttccgcaaccagttgccgaagataaattgataggtgaagaagatttt
gtggaatttgaagacgacgaccagattgtacgtctttccggtgattttgttatggacgaa
tttgctacaggatgtgtggttggtatatatggcatgcaatttgataatgatatctttcaa
gttaatgaggtgatttggccttccaaagcaccacaaccgacatatccgattctgaatgat
gacagatatgttgtattcgtctcaggattttcattcaccggccaagctgataaagatgct
gaaaagatattttctcttgatttgttgcagaaatggctctgtggctcgttaccgttattc
ggaaaggaacgtgatgttgtagaaagggtagtacgattggtagtagccggtgaaagtgtt
gctatcacggaacagggaagggaatttacgacagctgctcgttatctaattaaaaatgag
gaatgtccaaatgttgaatgtgtagcacatatggataaatttttatcaaaaatatctagt
ttgctggaagttgatgtaatgcctggcttaggtgacccatctacttacctaatgcctcag
caaccgattcatcgtgcagtatttgtaatgggttcaaaacacgggaagatgctcaatttg
gtaaccaatccttatcagttcagcttagaaggcgttcatattgtaggaacatccggcgaa
tgcttgtccgatctgaaacgtttcacgaaaagattaaatggtattgaattacttagcaaa
attctcgattggcaacatttggcaccgactattccggatactgtagatggatttccattt
atggatcgagacccatttattattgaatcattccctcatatactgtttgcagccaatcag
ccggaagcatcacatgctttagttgaatttgagggaaatcggcgcacactccttctttcc
ataccgagttttacgaaaacactctcagtggtacttgtgaacttacgaaacctcgaagtc
gttgaacatagctttgctgttgatcggctagtttgtaacacttaa

DBGET integrated database retrieval system