KEGG   Loa loa (eye worm): LOAG_07719
Entry
LOAG_07719        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_07719
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_07719
G protein-coupled receptors [BR:loa04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    LOAG_07719
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 9945142
NCBI-ProteinID: XP_020302257
AA seq 434 aa
MSGSVIGRERNTCLELVDQYIQTTATEANSTYCMANFDRSLCWQKTASGEVAQRKCPFSY
CLNVEGCEEIGNNYTVKRICNENGSWAEPMYAQCIDVLKYHPHCIVGFCRTCPDLLREMV
INVSLTLSIVSVALLLTALILFSILDSIQCQRLSIHKNLASSFVFRFTVLALWTVAQTTN
FFQDCSYYNSMPLYEYEWICKLLLWLVIYFQVASVMWMLIEGGYLYSRFTVFAMRSADYP
NYAFLFCGWGVPFAVVVSWTIIHQKRSSQNQNSFCWLPYAQGAHLWILSATMGLALILNL
LFLLGIVLILVQKLRAENTAESKKIWRTVKSTLLLVPLLGVSNIPLFYEPSQPSSVYMLG
SAILQHSQGIFIAVLYCFLNGEVQNAMKRQLLKLKMHILSEPRFEIERSYIPHEINKLDS
KLGMPMGKLNNTDG
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagtggaagcgttataggcagggagcgaaacacctgcttggaactggttgatcagtac
attcaaacaactgcaacagaagcaaattcgacatattgcatggcaaattttgatcgatca
ttatgctggcaaaaaacggcttcgggtgaagttgcacagaggaaatgtccattttcttac
tgtctaaatgtcgaaggttgtgaagaaattggaaataactataccgtaaaacgtatttgc
aatgagaatggtagttgggcagaaccgatgtatgcacaatgtattgacgttctaaagtat
catcctcattgtattgttggattctgtaggacgtgtccagatttacttcgtgaaatggtt
atcaatgtatcgttaactttaagcatcgtttctgtggcattgttgttaactgccctaata
ttgtttagtatattagactccatccaatgtcaacgtctttcaattcataaaaaccttgca
agctcctttgtatttcgatttactgtgctagctttgtggacagttgcacagacgacaaat
tttttccaggattgctcttattataactcgatgcctctatatgaatacgaatggatttgt
aaactgctactttggctggtcatttactttcaggttgcatcagttatgtggatgcttatt
gaaggtggctatttgtatagtcgtttcaccgtgtttgcaatgagaagtgctgattatcct
aattatgcttttctcttttgcggttggggtgtaccgttcgctgttgttgtcagttggact
attatccatcagaaacgatcaagtcaaaatcaaaattcattttgttggttgccatatgca
caaggcgctcatctatggatattatccgcgacgatgggcttagcattaattttgaattta
ttattcctgttgggtattgttctcatattagtgcaaaagttgcgcgctgaaaatactgct
gaatcgaagaaaatctggaggacggtgaagtcgacacttttattggtgccacttctaggt
gtttccaatatacccttattctatgagccatcacagcccagcagtgtttacatgcttggc
tctgctattttacaacattctcagggcatatttattgctgtattatactgctttttgaat
ggtgaagtgcaaaatgcgatgaaacggcaattattaaagctgaaaatgcatattttaagc
gaaccacgctttgaaatagaacgaagctatattccacatgagataaataaattggacagt
aaactgggtatgcctatgggaaagctgaataatacagatggctga

DBGET integrated database retrieval system