KEGG   Loa loa (eye worm): LOAG_07847
Entry
LOAG_07847        CDS       T02664                                 

Name
(RefSeq) flap endonuclease-1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_07847
   03410 Base excision repair
    LOAG_07847
   03450 Non-homologous end-joining
    LOAG_07847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_07847
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_07847
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_07847
Enzymes [BR:loa01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     LOAG_07847
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    LOAG_07847
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     LOAG_07847
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LOAG_07847
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LOAG_07847
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc DUF4142
Other DBs
NCBI-GeneID: 9945269
NCBI-ProteinID: XP_003143428
UniProt: A0A1S0TWJ8
AA seq 345 aa
MGVKDLSKVIGDHSPGSIRLKEFKGYFGRKVAVDASMCLYQFLIAVRQDGSQLQTESGET
TSHLLGMFYRTIRMIDNGIKPVYVFDGKPPQMKTSELEKRIERRAEAEKQRSDAVELGDE
ASVNKFARRLVKVTKEQNEEAKRLVTLMGIPVLDAPCEAEAQCAALARAGKVFATVSEDM
DALTFGSPILLRQMIASEAKKLPVKEMNLNQVLKDFGMNMEQFIDLCILLGCDYVSTIRG
IGPKKAFELIKKHECIENVLKIIDQTKYAIPKNWQYKEARRLFLEPDVMDCENVELVWKE
PDVEGIVQFLCGEKSFNEDRVRGSLTRMQKGRQAAQQIRIDSFFW
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgggtgtgaaggatctatcgaaggtgatcggggatcactcgccgggtagtatacgactc
aaagaatttaaaggatattttggtcgcaaagtggcggtggatgcatcaatgtgcctctat
caattcctcattgcggtgcgacaggacggatcacagcttcagacggaaagcggcgaaaca
accagtcatcttcttggaatgttttatcgaactattcgaatgatcgataatggaataaaa
ccagtgtatgtattcgacggtaagccaccgcagatgaaaacgagtgaattggagaaacgt
attgagcgaagagccgaagcagaaaagcagcgaagtgatgctgtcgaactaggcgacgag
gcatccgtcaacaaatttgcgagacgtcttgtaaaggttacaaaagaacaaaatgaagaa
gctaaacggttggtaacattgatgggaattccagtattggatgctccatgtgaagcggaa
gctcaatgtgccgctcttgcgagagctggtaaagtgtttgctacggtttctgaagatatg
gatgcattaactttcggttcacccattcttttgcgtcaaatgatagcaagtgaagcgaag
aagctgccagtgaaggaaatgaatttgaatcaagttttgaaagatttcggaatgaatatg
gaacaatttatagatctctgcattctattaggttgcgattatgtatcaaccattcggggc
attggtccaaaaaaagcatttgagcttatcaagaagcatgaatgcatcgaaaatgttctc
aagataattgatcaaacgaaatatgcgatacctaaaaattggcaatacaaggaagcacga
cgacttttcttggaaccggatgtcatggattgtgaaaatgttgaattagtttggaaagaa
ccggatgtcgaagggattgtacaatttctatgtggtgagaaaagtttcaatgaagacaga
gtgaggggtagcttaactagaatgcaaaaaggacgtcaggctgcacaacaaattcgtatc
gactcttttttttggtaa

DBGET integrated database retrieval system