KEGG   Loa loa (eye worm): LOAG_07925
Entry
LOAG_07925        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
loa04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_07925
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_07925
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_07925
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_07925
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_07925
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     LOAG_07925
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    LOAG_07925
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    LOAG_07925
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     LOAG_07925
SSDB
Motif
Pfam: PARP PARP_reg WGR WWE DUF3829
Other DBs
NCBI-GeneID: 9945350
NCBI-ProteinID: XP_003143505
UniProt: A0A1S0TV12
AA seq 755 aa
MDDPVGSEDDTVMDIAADDQNSDAGGAATYRKLVWEYELSRGRWIKYENAVSGKLNESIA
NNVADFEMDESKLQIDFNLMKQKNLSTGFVRSVRCAIRNDEGVYRVWEYIDSKRRWRSMD
PTSVITLENAFVNGSGNVKILLSGINFIADFDSNLIRSDDGLTEYKIRSYISNAEPSMSA
KPVPRIERLRAVKRIAARTNTPSTESKRKAMWEKDDKNDTDRNDNNNEKQSNQPKRTRRK
GNSNSGSQKSNDSSSSTDNKTDLEKVIPKGAAVVDPECHGLIGTAHVYTDSSDVYDALLN
QTNAQHNNNKYFIIQLLECDEEKRYWVWFRWGRVGYKGQTSLNPCDTNLTLAKKLFCDKF
KNKTANDWTERTNFKKVVGKYDYLPADYSKTIEEKKNENDAKEKKEIESKLDAYLLHLLN
IICDIRTMEETMTGLEYDATKAPLGKVTDEQIKAGYAALTRIEEHIKKKDFSSSFVETVN
NYYTKIPHFFGMRQPPMIKTVEQLKAEIKLLEALNEIEMAIRTFKKEGDVNIHPIDRHYM
NMKCEISLLSANNPMYKLVNNYLQWTHGPTHNMYRMRIRNLYAINREGEQEKFMFDVGNR
KLLWHGSRLTNWFSILSQGLRIAPPEAPTTGYMFGKGIYFADMSTKSANYCYPQKNKPGF
LVLAQVALGEMHELLQGDIHASKLPAGRNSTKGLGSIVPDPATYVTLDDCEIPCGKPVTV
QPKGGASSLIYNEYIVYDVKQVWIRYLIEIDFIFN
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggatgatccggtaggaagtgaagacgatactgttatggatatagctgcggacgaccag
aatagtgatgcaggcggcgcggcaacatatagaaagttggtttgggaatacgaattgagc
cgcggaagatggatcaagtatgaaaatgcagtcagcggaaagttaaatgagagcatagca
aataatgttgcggactttgaaatggacgaatctaaattacaaatcgatttcaacttaatg
aaacagaaaaacttgagtaccggttttgttcggtctgtgagatgcgctattcgaaatgac
gaaggtgtttaccgtgtctgggaatacattgattcgaaaagacgttggcgaagtatggat
ccaacatctgtcataacattagaaaatgctttcgttaatggatctggaaacgttaaaata
ctgctgtcgggaataaatttcattgctgatttcgacagtaatctaatcagaagtgacgac
ggattgacggaatataaaatccgttcatacatctcgaatgccgaaccctcaatgtcagca
aaaccagttccaaggatcgaacgtcttcgtgcagtaaaacgtattgcagcacggaccaat
acaccctcgactgaaagtaaacgaaaggcgatgtgggagaaagatgacaaaaatgatacc
gatagaaatgataataacaatgaaaaacaaagtaatcaaccaaaaagaactcgtagaaaa
ggaaatagtaattctggaagtcaaaaatcaaatgattcgagtagcagtactgacaataag
accgatttggagaaagttataccgaagggcgctgcggttgtggatcctgaatgtcatgga
ttaatcggcactgcacatgtttatactgattccagcgatgtttatgacgctttattgaat
cagaccaatgcacaacacaataacaataaatattttattatacaactgttagaatgtgat
gaagaaaagcgctattgggtttggttccgttgggggcgcgtcggctacaaaggacaaacc
agtttgaatccatgtgatacaaatttgacacttgcaaagaaattattttgtgacaagttc
aagaacaaaacagcaaatgactggacagaaagaaccaatttcaagaaagtagttggcaaa
tacgactacttgcctgctgattactcgaaaacaatagaagagaaaaagaatgaaaatgat
gctaaagagaaaaaagaaattgaatcaaaactggacgcttatctgctacatttattaaac
attatctgtgatatacgaacaatggaggaaacgatgacaggattggaatatgacgccact
aaagcaccgctagggaaagtaacggacgagcaaattaaagctggttatgcagcgctgaca
aggattgaagagcatattaagaaaaaggatttctcgtctagttttgtggaaactgtcaac
aattattacacaaaaatacctcacttttttgggatgcgtcagccgccaatgattaagaca
gtggaacagctaaaagctgaaattaaattgttagaggctttgaacgagattgaaatggct
atacggacattcaagaaggagggagatgtgaatattcatccaatcgatcgtcattacatg
aatatgaaatgcgaaatatcactcctaagtgcaaataatcctatgtataagcttgtgaat
aattacctccaatggacgcatggtccaacgcataatatgtatcgtatgcgcattcgtaat
ttgtacgcaataaatcgagagggagaacaggaaaaattcatgttcgatgttggcaacagg
aagttattatggcatggatctcgattgacaaattggtttagtatcttatctcaaggattg
cgaattgccccaccagaggctcctacaaccggttacatgtttggtaagggtatttacttt
gctgatatgtcaacaaaatcagccaattattgctacccacaaaaaaataagcctggcttt
ttggtattggcgcaagtcgcgttgggagaaatgcacgaattactgcaaggcgacattcat
gctagcaagcttcctgcaggaaggaatagtactaaaggattaggttcaattgttcccgat
ccagctacatatgtcactttagacgattgtgaaataccgtgtggtaagccggtcacagta
caaccaaaaggcggggcttcttcacttatttataacgaatacattgtttacgatgtaaaa
caagtttggattcgttacctcattgaaattgatttcatttttaactga

KEGG   Loa loa (eye worm): LOAG_17111
Entry
LOAG_17111        CDS       T02664                                 

Name
(RefSeq) WGR domain-containing protein
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
loa04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_17111
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_17111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_17111
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_17111
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_17111
Enzymes [BR:loa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     LOAG_17111
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    LOAG_17111
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    LOAG_17111
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     LOAG_17111
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1
Other DBs
NCBI-GeneID: 9940767
NCBI-ProteinID: XP_020306664
AA seq 871 aa
MASSAKDLPYGAEYAKSNRASCKGCHGLISQDSLRMSLRKPSHFFDGLQDNWFHFTCFWK
KVKPDDVSEASIRGMELLKWSDQEQIRKKINENQAGTSNVREISVMLISEYAVTGRSKCL
NCKGNIKKNTLRLGMKSAWYHVNCFEKIEPYTSCAEKIVGFQNLSKSDQDILKTMFNKQA
ETSIKRKLTKINDNVAKKAKIEQIDTEEKMGRLKAQADEMWSVRKKLSKCLNKNDIQILL
QANNQALPKHGGETKLLDRLVDCIVFGCPLPCKQCKEGNIVYSSSQKSYVCTGYLSEYTR
CMYTCRNPPRKPFVVPDGMKRSICEFKNFKAKDPKNREYSALEYEKPTKSKSLKVLGQRV
GEMSRKCMKRGNTDSKDSRMQQQIIKNGTVVDVECPLQEVVHVWKDENGKLWETTLGKAD
FQTGANSFYKLQLLKHDVKQNYYVFRSWGRVGTDIGGAKTDKYHGHLEEAKMTFEKLFYE
KTANNWKDVENFKKVPEKMSLIETHYGNLKELQTSVVKPGSLSKLPGSIQQIITMIFDVN
AMNDVLESLEIDTGKMPLGILSIRHIKNAYKILTELQTLMEVGNAKYEDYLDATNRFFTL
IPHNFGMNKPPLLNSQKLLIDKAKLLDDLLELEVTYSILKSDDRRDRTRDPVDVHYEKLH
AELELLDKQSDEYRRILQYAANTHAPTHDQYKLEIVDIIRVKREGESERFKKDIPNHYLL
WHGSRITNYAGILSQGLRVAPPEAPMTGYMFGKGIYFADLISKSANYCYAVNTEGFILLC
EVALGEMQEEINAKSITKPDKGKHSVKGLGQTIPDPNEHFVTEDGVTIPMGKPIDTKRQD
LSLLYNEYIVYDVAQVEIKYLVRAKFISSLF
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggcgtcatctgcaaaagatttaccttacggtgctgaatatgctaaaagtaatcgtgct
agttgcaaaggatgtcacggtttaatttcgcaagattcgcttcgtatgtctttacggaaa
ccaagtcatttttttgatggcctacaagacaactggttccattttacttgtttctggaaa
aaagtaaagccagatgatgtaagcgaagcctctatacgtggtatggagcttctaaagtgg
agtgatcaagaacaaattcgtaaaaaaataaacgaaaatcaagctggaacatctaatgta
agagagatctctgttatgcttatctctgaatatgctgtaactggccgtagcaaatgtttg
aattgcaaaggaaacatcaagaagaatactctcagacttgggatgaaatcggcatggtat
cacgtaaactgttttgagaaaatagagccgtataccagctgtgctgaaaaaattgttggt
ttccaaaatttgtcaaaatctgaccaagatatcttgaaaacgatgtttaataagcaagca
gagaccagtataaagagaaagttgacaaaaatcaacgacaatgtagccaaaaaggcaaag
atcgaacaaatcgatacagaggagaagatgggacgtcttaaggcacaagcagacgaaatg
tggtcagtgaggaaaaaattatcaaaatgtctgaataaaaacgatattcagattttgtta
caagccaataaccaggcacttcctaaacacggtggggaaacgaagctgcttgatcgtctt
gttgattgtatagtttttggctgtccgctcccttgtaagcagtgtaaagaaggtaacatt
gtttacagctcatcacaaaaaagttatgtttgtaccggttatctttccgaatatacacgg
tgtatgtatacatgtcgcaacccgcctcggaaaccgtttgttgttcctgatgggatgaaa
agaagtatttgtgaatttaagaattttaaagccaaggatccgaaaaacagggaatatagt
gctctagaatatgaaaaaccaactaaatcaaagtcgctgaaagtactgggtcagagggtt
ggtgaaatgagcagaaaatgtatgaaacgcgggaatactgattctaaagattctcgaatg
caacaacagattataaaaaatggaacagtggttgatgtcgaatgcccgcttcaagaagtt
gtacatgtatggaaagatgaaaatggcaaactttgggaaacaacgctgggaaaggcggat
tttcaaactggagcgaactcattctataaattgcaactattaaagcatgatgtcaagcaa
aactattatgtgttccgttcatggggacgtgtcggcacagacattggtggcgcaaaaacc
gataaatatcatggacatctggaagaagcaaaaatgacttttgaaaaattgttctatgag
aagacagcaaataattggaaagatgttgaaaatttcaagaaagttccagagaagatgtca
cttattgagactcattatggaaacttaaaagaactgcaaacatctgttgtgaaacctgga
tcgttatcaaagctgccaggatcgatacagcaaatcattacaatgatttttgacgttaat
gcaatgaacgatgttcttgaaagtcttgagatcgatacaggtaaaatgcctctcggaata
ctatcaattcgtcacataaaaaatgcatataagattttgacagagctgcaaacattaatg
gaagttggtaatgccaaatatgaagattatttggatgcaacaaatcgatttttcactctt
attccacataactttggtatgaacaaaccgccgcttctcaactcgcagaaactcttaatt
gataaggcgaaactacttgacgatcttttggagcttgaagtcacatacagcattttgaag
tctgatgatagaagagatcgaacgcgagatcctgtggatgttcactatgaaaagttacat
gctgagctagagttactggataagcagtcggacgagtacagacgcatactgcagtatgct
gcgaatacgcatgcacctacacacgaccaatataaacttgaaattgttgatatcattcgg
gtaaagcgtgaaggcgaaagtgaaagattcaaaaaagatatcccaaatcattatttactt
tggcatggttcacgaataacgaattatgcaggaattttatcacagggattacgagttgca
ccgccagaagcacctatgacgggttatatgtttgggaaagggatatacttcgcagatttg
atatcaaaatcagcaaactattgttatgcagttaacacggaagggtttattttgctttgt
gaagtggcacttggggaaatgcaggaagaaatcaatgcgaaatcaatcacaaaacctgat
aaggggaaacatagtgttaaaggcttaggacaaacgattcctgatccaaatgagcacttt
gtgacagaagacggtgtgacaattcctatggggaaacctatagatacgaaaaggcaggat
ctgtcgcttttgtacaatgagtatattgtttacgatgttgctcaggttgaaattaaatat
ttggtgcgagctaagttcatatcatctctcttctga

DBGET integrated database retrieval system