KEGG   Loa loa (eye worm): LOAG_08792
Entry
LOAG_08792        CDS       T02664                                 

Name
(RefSeq) U6 snRNA-associated Sm-family protein LSm
  KO
K12620  U6 snRNA-associated Sm-like protein LSm1
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_08792
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_08792
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_08792
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     LOAG_08792
SSDB
Motif
Pfam: LSM YCII
Other DBs
NCBI-GeneID: 9946219
NCBI-ProteinID: XP_003144370
UniProt: A0A1I7VBB9
AA seq 139 aa
MELPDPYLPGALSLLEQLDKKLLVVLRDGRTLIGYLRTIDQFANLVLHETLERIHVDKYY
GDIQRGVFLIRGENVVLAGEIDETKEQSSGLIPLSAKEILSLQREKIEEKERFEEARNKI
MKGRGRRVKPVVDVFNDES
NT seq 420 nt   +upstreamnt  +downstreamnt
atggagttaccggatccatatttacccggtgctttaagcttgttggaacaactcgacaag
aaacttctggttgtccttcgtgatggacgtactttaattggttacttaaggacaattgat
cagtttgcaaatttggtattgcatgaaactttagaaaggatccatgttgataaatactat
ggtgatatacaacgtggagtatttttaattcgtggggaaaatgtcgttctagcaggtgaa
attgatgaaacgaaagagcaatcttcaggtcttattccactttctgcaaaagagatcctt
tcgttgcaacgagaaaaaatagaggagaaagaacgattcgaggaagctaggaataaaata
atgaaaggacgtggtcgtcgggtaaaacctgtagttgatgtttttaatgatgaatcatga

DBGET integrated database retrieval system