KEGG   Loa loa (eye worm): LOAG_08799
Entry
LOAG_08799        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K14443  protein Tob/BTG
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_08799
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_08799
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_08799
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     LOAG_08799
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 9946229
NCBI-ProteinID: XP_020302004
AA seq 295 aa
MYTEIKELINFLAVFMHHRIARRRISLCMESFANHLATRFHDNWRPDEPKHAQAERILAI
KTRGGMDEMFIAVAASVGINGDDLYASFPTTIFIYCNPGEVTCRISDYPSIVIIWRGDVD
ADKFYIPTPIGAAKYYDGNSHNIQNTVLNAYVKQESMLRPAGHAKKRDVKPERCIPLTLV
SSAEIDAYDLLATGFIDINEVPPVLFRYKRANSKQFTVRSFAATRFGSHRPRPDHKAMRR
IQHAAAYLAITNANAIQQANVPLLENFPVNFQFAMGPEGGNGKCCGCKDLSLLFG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtatacagaaatcaaagaattgatcaactttttggctgttttcatgcaccatcgtatt
gcaagacgtcggatcagtttgtgcatggaaagttttgcgaatcatttagcaacaagattt
catgataattggcgccctgatgaaccaaaacatgctcaagctgaacgtatcttggcaatt
aaaacacgtggaggtatggatgaaatgttcattgccgttgcggcaagtgttggcatcaat
ggggatgatctttatgcaagctttccaacaaccattttcatctactgtaatcctggtgaa
gtaacttgccgcatttcggattatccatccattgtgattatttggcgtggcgatgtggac
gcggacaaattttatattccaactcctattggtgctgcaaaatattacgatggaaactca
cacaacattcaaaataccgttttgaatgcttatgtaaagcaagaatcaatgcttcgtcca
gctggacatgcgaaaaaacgagatgtgaaaccggaacgctgcattccgctcactttggtt
agctctgctgagattgatgcatacgatctgcttgctactggtttcatcgacataaacgag
gttccaccggttttatttcgctataaacgagcgaattcgaagcaattcacggtgcgttca
tttgctgctacgcgtttcggttcgcatcgaccgcgaccggatcataaagctatgcgtcgc
attcagcatgctgctgcatatcttgccataacaaacgcaaatgcaattcaacaagctaat
gtaccgctacttgagaattttccggtgaattttcagtttgctatgggtccggaaggtggc
aatggtaagtgttgtggttgcaaagatttatctctgttgtttggttaa

KEGG   Loa loa (eye worm): LOAG_09500
Entry
LOAG_09500        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K14443  protein Tob/BTG
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_09500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_09500
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_09500
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     LOAG_09500
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 9946938
NCBI-ProteinID: XP_003145075
UniProt: A0A1S0TTD5
AA seq 213 aa
MLVEIEQTVGFLASFLYGTIPRRRIDTFAEILANRLLERLMDQSRPPKICHLVVNVAGKS
DPLIQDAVEEAYMDLTEMQSLLPNNLIVEIRQGSVNAVNADTGGRRFRNRSALSPNSKSR
HGQETKRRPLLRIEYEYRCVGGENKPCGRPYFELQRDDAVYTAQAFAATRFGSTKLKSHQ
NYRVLIRISSEKSSDCENDQSRDSKEFLTSSRL
NT seq 642 nt   +upstreamnt  +downstreamnt
atgctggtcgaaattgaacagactgtgggtttcctagcctcgttcttgtatggaacgatt
cctcgtcgccgcatcgacacgtttgctgagatcttggctaatcggttactggaacgcctg
atggatcagtctcgcccaccaaaaatttgccatttagtcgttaatgttgccggaaaaagt
gacccccttattcaagatgcagttgaagaagcttacatggacttgacagaaatgcaatct
cttcttcccaacaatttgattgttgagatacgacaaggttccgtaaatgcagtcaatgca
gatactggtggacgtcgtttccgcaaccgctccgctttgtcgcccaattcgaaaagtcgt
catgggcaagaaacaaaaagacgtcctctgctgcgtatcgaatatgaatatcgctgtgtg
ggtggggaaaataaaccgtgtgggcggccatatttcgaactgcaacgggatgatgcagtc
tacacagctcaggcctttgctgcgacacgttttggatccaccaagcttaaaagtcatcag
aactaccgagtactcatcagaatatcgtcggaaaaaagctctgactgtgaaaacgatcaa
tcaagagattccaaagaattcctcacatctagtagactttga

DBGET integrated database retrieval system