KEGG   Loa loa (eye worm): LOAG_09226
Entry
LOAG_09226        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12618  5'-3' exoribonuclease 1 [EC:3.1.13.-]
Organism
loa  Loa loa (eye worm)
Pathway
loa03008  Ribosome biogenesis in eukaryotes
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    LOAG_09226
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_09226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_09226
   03009 Ribosome biogenesis [BR:loa03009]
    LOAG_09226
   03016 Transfer RNA biogenesis [BR:loa03016]
    LOAG_09226
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_09226
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     LOAG_09226
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     LOAG_09226
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     LOAG_09226
Ribosome biogenesis [BR:loa03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    LOAG_09226
Transfer RNA biogenesis [BR:loa03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    LOAG_09226
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    LOAG_09226
SSDB
Motif
Pfam: XRN_M XRN1_D1 XRN_N SH3_12 Meiosis_expr
Other DBs
NCBI-GeneID: 9946661
NCBI-ProteinID: XP_020301924
AA seq 1318 aa
MDFIRSERSRSDYDANTRHCLYGLDADLIMLGICSHEPHFALLREEVKFGRQRNHNGKHK
TGVNEITFHLLHLSLLREYLSWEFHSLKEKLPFEYDLESVIDDWVLMGFLVGNDFIPHLP
HVHIHEDALPLLYATYNEVLPQLDGYINEAGVLNLKRFEIFLKNFAKNDRKNFIEQMDDE
AYLSSKRISNAWKKGPNDQQNCDEDLEPFDLSDAEKTEITEKDSRKGAFDSDSNASDECE
EIAGPRILTAAKRMTHGYFGLDKDSDNDLPIALLDDESYENDYDQSSWTPVVSRAFKNHK
RDYYNDKMKYSNISKEELREQAEGYIRAIQWNLHYYYHGCCSWSWFYPHHYAPYISDVSD
FAEMEMNFDLSEPFKPFEQLLAVLPAASADCLPLPYRELMSDPKSPIIDFYPEQFDTDLN
GKKNDWEAVVLIPFIREDRLLQAMAIKDPLLTDEERKRNLHGPHLLFSYDPSSSHILKST
FPDTFPDIQECTVKIDEVGMNQFRISRNQIVHGLLPGVKLGVIFPGFPTLKHIPHIAELH
FADIRVFQQPSKKQSMILRITKRPELEKDMMAIAFDLVGTEVHVNWPVLQKAWVQEIWTD
HEKYIKTSDEKIICDSLSEEEQNVYSGYVSITRRNEFERRGIDAGEQKGLALVQVAQGSR
KCFEEQKVVIKRSYVDINNAIPVSLSLVVQNALEDWDSACSFEDLYPMNAQIFISSVESK
YYGFCGFIKENHLATKGTLTVSCKIPLTVDMSFCDILANYDNYALKWYSIYEVARSLRTT
VDVIGRITGCVYVSLNESDSISSRNVPLNKINIGLGLKFTKRNQIVPDFTRRSSEGHCLY
SSRAFDMIRNYKMKYPRVFTHLEELNNFQGHIKQIFPGLDGKELNAKLEELKNFLHTVVP
KDSLESADSTFVDSGVLKEVEKRTQIVISKSTLKQTCKRLAVKPRAIFMTELCKGDIMPD
PGTEFRLLDRVICVKKLHIAPFGEFGTVIGLLNTGSGQKIDVLFDKPYFGGKIMRSGKAS
GARLPISSVINITHGKRMRKEIPVVEHTVSPVTAKRKPVNFPHNTCLNKSGFHQQIPFGA
PRTAPRNKISKPGTGLEEERKTFGSKSSPNVVRRTQEMRDEMSFGKTGANNKVVKSGGIS
GIPLCSGFNPHQEYALPEGVFGLQSKGQSSAFKNPTFDRLSRDHDKMWRSSRQSEFTVSR
NADYGQAGLSGARNVISKQPGFDKNIGSQFTGGIAVRDAGEEMKSHKLRHGYPRAWFGCQ
SVKAKDYLPCSLEGASTEQSSSKSTRIQKRMPQEKRPRLHRLRELLYLKKQFAGCGRG
NT seq 3957 nt   +upstreamnt  +downstreamnt
atggattttatacgtagtgaaagaagtcgttctgattatgacgctaacacaagacattgc
ctctatggtcttgatgcagatttgataatgctgggaatatgttcacatgagcctcatttt
gctttactgcgggaagaagtgaaattcggaagacaaaggaatcataatgggaaacataaa
acgggagtaaacgaaataacattccatttattgcatctttcattgcttcgagaatatctt
tcatgggaatttcattcattgaaggaaaaactgccatttgaatacgatttggagtcagtg
attgatgactgggtactcatgggttttcttgttggtaatgattttattcctcacctccct
catgttcatattcatgaagatgctttaccgcttctttacgctacttataacgaagtacta
cctcagttggatggttatatcaatgaagcgggtgttttaaatttgaagcgttttgaaatt
ttcttaaaaaattttgcaaaaaatgataggaaaaattttatcgaacaaatggatgatgaa
gcatatctcagttcgaaaagaatatccaatgcttggaaaaaaggccctaatgatcagcaa
aactgtgatgaggacttggagccgttcgacctttctgatgctgaaaaaactgaaattact
gaaaaagattctcgtaaaggagcatttgattcggacagtaatgcttctgacgaatgtgaa
gagattgccggtccaaggattttaaccgctgctaaaagaatgactcatggatattttggt
ttggacaaagattccgataacgacctgcctattgctctgttagatgacgaaagctatgaa
aatgattatgatcagtcatcttggactccagtggttagtcgggccttcaagaatcacaag
cgtgattattataacgataagatgaagtatagtaacataagtaaagaagaactacgtgaa
caagcggaaggatacattcgtgcaattcaatggaatttgcattactactatcatggatgt
tgtagttggagttggttttatccacatcattatgctccttacatatcggacgtttcggat
tttgctgaaatggaaatgaattttgatttaagtgaaccatttaagccatttgagcaatta
ttggctgtattacctgcagctagtgctgattgtttgccacttccttatcgagagcttatg
agtgatccaaaaagtccaattattgacttttatccggagcaattcgacactgatttgaat
ggcaaaaagaatgattgggaagcggttgttctgataccgtttattagggaagatcgcctt
ctgcaagccatggctatcaaggatcctttattaactgatgaggaacgaaagagaaaccta
catggtcctcatctgctgtttagttatgacccctcatcatcacacattctgaaatctaca
ttccctgatacttttcctgatattcaggaatgcactgtaaaaatagacgaagtaggaatg
aatcaatttcgcatatcacgtaatcaaatagtgcatggtttgttacctggagttaagctt
ggtgttatatttcctggcttccccacgctgaaacatatacctcatattgctgagcttcat
tttgcggacatcagagtcttccagcagccatctaaaaagcaatcgatgattctaagaatt
acaaagaggccagaactcgaaaaggatatgatggcgatagcatttgatttagttggaaca
gaagtacatgtgaattggcctgtgcttcagaaggcttgggtgcaggaaatatggactgac
catgaaaaatatatcaaaaccagtgacgaaaaaattatttgcgacagtctgtcggaagaa
gaacaaaatgtgtatagtggttatgtcagtataactcgaagaaatgagttcgaaaggcga
ggtattgatgctggtgaacagaaaggtttggctttagttcaagtagcacaaggatcgcgg
aaatgtttcgaagaacaaaaagtcgtaattaagcgatcttatgttgatattaacaatgct
attcctgtgtcgctttcccttgtggtacagaatgcactggaagattgggattctgcatgt
tcctttgaggatttatatccaatgaatgcccaaattttcatttcttcggttgaaagtaaa
tattatggtttttgtggatttatcaaggaaaatcatctagcaacgaaaggaacacttact
gtttcgtgtaaaatcccattaacggtggatatgagcttctgtgatattttagcaaattat
gacaattatgccttgaaatggtacagcatatatgaagtagcaaggtctttgcgtaccacc
gttgatgttattggtcgcatcactggttgtgtttatgtttcactgaatgaatccgattca
atatcatcaagaaatgttccgctgaataaaatcaatattggtcttggattgaaatttaca
aaaaggaatcaaattgtgccagatttcacacgtcgttcatcggaaggacattgcttgtat
tcgtcaagagcgttcgatatgattcgaaattataaaatgaaatatccccgagtattcaca
catcttgaggaactgaataacttccaaggacatatcaaacagatattcccgggacttgat
ggaaaagaattaaatgcaaaacttgaagaattgaaaaactttttacacactgttgtgcca
aaagattctctggaatcagctgacagtacttttgtggactctggcgttttgaaggaagtc
gaaaaacgaacacagatcgttatctccaaaagcacactaaaacaaacttgcaaacgactt
gcggttaaaccccgtgctatttttatgacagaactgtgtaaaggagatatcatgccggat
ccaggaactgaatttcgtttactggatcgagttatttgcgtgaagaagctccatatagca
ccatttggcgaatttggtactgttattggactgcttaatacaggatcggggcagaaaatc
gatgtattgtttgacaaaccatattttggaggcaagattatgcgaagtggtaaggcaagt
ggagctcgactgccgatatcttcagtgattaacataacacatgggaaacgaatgcgaaag
gaaatcccagtcgttgagcatactgtaagcccagttacagctaaacgtaaaccagtgaat
tttccacataacacatgcctgaataaaagtggatttcatcagcagattccatttggagct
cctagaactgctcctagaaataaaatatccaaaccgggaactggcttagaagaagaaaga
aaaacatttggaagcaaatcgagtccgaatgtagttcgacgtacacaagaaatgcgagac
gagatgagttttgggaagacaggagctaataacaaggtagtaaaaagtggtggtattagc
ggaattcctttatgcagtggttttaatccacatcaagaatatgctttgccagaaggagtt
tttgggttgcagtctaaagggcaaagctcagcttttaaaaatccgacattcgatagatta
tcacgagatcacgacaaaatgtggaggtcgtcgagacaatcagaattcactgttagtaga
aatgcagattacggacaggctggattaagtggtgccaggaatgtcatttctaaacaacct
ggttttgataaaaatatcggcagtcagtttacaggaggaatagcagttcgtgatgctggt
gaagaaatgaaaagccacaaactgcgtcatggatatccacgagcatggtttggatgtcag
tccgtgaaagccaaagattatcttccatgttctcttgaaggagcctctacagagcagtct
agctctaaatccactcggattcagaagcgaatgccacaagaaaaaagaccaagacttcat
cgcctgcgcgaattactctacttaaaaaagcaattcgcgggatgtgggagaggttag

DBGET integrated database retrieval system