KEGG   Loa loa (eye worm): LOAG_09571
Entry
LOAG_09571        CDS       T02664                                 

Name
(RefSeq) DNA polymerase epsilon p17 subunit
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_09571
   03410 Base excision repair
    LOAG_09571
   03420 Nucleotide excision repair
    LOAG_09571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_09571
   03036 Chromosome and associated proteins [BR:loa03036]
    LOAG_09571
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_09571
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LOAG_09571
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    LOAG_09571
Chromosome and associated proteins [BR:loa03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    LOAG_09571
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      LOAG_09571
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone
Other DBs
NCBI-GeneID: 9947008
NCBI-ProteinID: XP_003145146
UniProt: A0A1I7VQ77
AA seq 166 aa
MTDGDVAEDLRLPQTVIGRLVKEALPPGVIISKDARTAIARAAAVFILHAATYAQECAVS
SKRKTVAAVDVLNAVRVLECEELEKPVKEAVEIWKANRQQRNEEAKKRKAGRVQNNDPAV
LEILKNVSQRGGISVSGHVNSTDNTVASDEPETKKMLLDVIMDDES
NT seq 501 nt   +upstreamnt  +downstreamnt
atgacggacggagatgtggctgaggatttgcgactaccacaaactgtcattggtcgtttg
gtaaaggaagcactaccacctggtgttatcatttctaaggatgcgcgaacagcgatagca
cgagctgcagcggttttcatcttgcatgctgccacgtatgctcaagaatgtgctgtatct
agcaaacgtaagacggttgcagcggtggatgtcttaaatgcggtgcgagttttggaatgc
gaagaactggagaaaccggtaaaggaagcagtagagatatggaaagccaacagacagcaa
aggaatgaggaagctaaaaaacgaaaggcgggacgtgtgcaaaataatgatccagctgtg
ttagagattctaaaaaatgtttcacaaagaggtggaatttccgtatccggccatgtcaat
tccacagataatacagttgcttcagatgaacccgaaacgaagaaaatgttgttagatgtc
attatggatgatgaaagctaa

KEGG   Loa loa (eye worm): LOAG_16711
Entry
LOAG_16711        CDS       T02664                                 

Name
(RefSeq) DNA polymerase
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_16711
   03410 Base excision repair
    LOAG_16711
   03420 Nucleotide excision repair
    LOAG_16711
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_16711
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_16711
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LOAG_16711
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    LOAG_16711
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      LOAG_16711
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 HECW_N
Other DBs
NCBI-GeneID: 9946427
NCBI-ProteinID: XP_020307130
AA seq 2288 aa
MALTLGLLETFLAGKNRISSETIYFYVCISDYEFCSSLNELRPFSNILKLDSSYGSRLQK
IRSSEILDQKFGFQRYTDIEWKNAWLLNVQSAEMIDEQTKNIIAVCDFYFLEEDGGRFKI
SYPFRPYLYIATLPSFEHQVLSYLSKKYTSVITTDIVEKEDLDLKNHLAGLKRTYLKISF
PSLSELLKFKKDIMPILRRNQEREKQTTSYTNLLTRHFGPREVLFDEGGVLEKIIDLREH
DLPYQMRVCIDMEVFVGLWYRVTGRDFDRRPKITRHPTLIDPPEPIILAYDIEVTKLPLK
FPDSTFDEIMMISYMVNGNGFLIINRQIISTDVDDFEYTPKPEYKGIFRVINLPDEKAVI
KYFFDHIIRLRPSVFVTYNGDSFDWPFVEARAAVHGLNMLTEIGVSKNSSGEYRTTNAVH
LDAFRWVKRDSYLPVGSQNLKSCTKAKLRYDPVELDPEEMCAMAKDEPQTLANYSVSDAV
ATYYLYIKYVHPFIFALCTIIPLGPDDVLRKGSGTLCEALLMVKAFHNNIIFPNKSLPYG
AKYASDGHVIESETYVGGYVEALESGVFRADIPEKFRIVPAAILDLKRNVRKTLSDSLTH
EFGVNMDEVLRKGSGTLCEALLMVKAFHNNIIFPNKSLPYGAKYASDGHVIESETYVGGY
VEALESGVFRADIPEKFRIVPAAILDLKRNVRKTLSDSLTHEFGVNMDEVVNFDSVVSKI
ETQLDDFIKRPLRLETPKIYHLDVGAMYPNIILTNRLQPSAVVTNEDCIACVYNSPDAKC
RRTMRWEWRGEIMPASRGEYERILQQLENETFGKPPRAFHSLDHDQRIQIEIKRVKDFCK
RAYGKTHITKNEYRYTTICQRENAFYVDTVKAFRDRRYEYKAMLKKAKAVLDEVSDDDIH
ALKTAQGRVVLYESLQLAHKCILNSFYGYVMRKGARWFSMEMAGIVCHTGANIITEARKL
VERIGKPLELDTDGIWCLIPGTFPENITFTLNNSKRKTVTISYPGAILNALIHDKFTNNQ
FHQLELDGTYSITSENSIFFEVDGPYLAMILPASREEGKRLKKRYAVFNFDGSLAELKGF
EVKRRGELALIKYFQSSVFKAFLKGKNHPEAYEHAAKEANYWLDVLFSKGATIPDYELFD
LIAENRSMSKKLDDYGEQKSTSISTAKRLAEFLGDDMVKDVGLACRFIISKMPLDAPVAQ
RAIPLAIFQAAPNVSAHYLRKWTKDTTITKDNINIRNIIDWEYYIERFGATIQKIISIPA
ALQNVPNPVPRVPFPDWLENKRQQRKNDHKQPKINEIFKKATTLAFTPDIENINSSRAAS
NSSLNNVTLLSNSPNSEKDSSTTTTCVFLNVAAKQSQSSSLTKITDRWERFLRILMMKTV
KDVIGFQSSNFVTKRTYLKAKWQKERAEKNRRKQNALSKGITPIMSMLERGKQMMRDTAW
QIVKISETPSKGMLALWCIILDKMMKINLRMPRIIYVNNREENGNSGILVKRILPRLKPV
FNLRQYVIDERIFESSLNQLNKELCAMRIEGVYESQVPLLFRALLTFGCSCRLKPNLQTN
STATYDFEQLEPDFSVQYLPENSVRTLFFYEHQQDNRCVIAVFNTATSEAHIVVVNKTEL
NLPNLSNMYASEKANLSADVIVSFLSRKADMNFTVSQCSAVQRADRIIQRYIRSLLHVDS
YPTVIAVQSRQQLSALVKRLPALDSYPLVRIHASEPSGLFNVLDWQRIVLRRIIKHYFNM
FLYLHQYVEVSRYLHIPIGNIPEDFSTFGPDVLFARSLINQGYVLWASPLSRPDLGGKEL
DDTRLNAVWSSLSINKQSVCVVNESSFETDVCIELELGAVDVTAIVQSASIADAEGGADS
VGFLTGSVLSADALLGYVRSIAQYDEGAAVAGPLKVLRLLLHDCIKDIHLYGSKIADQVI
ISLDRWLRTQHSLMYDPAIVRVVDILITKLILLLVAELNRLGGRVIYASSSQLIMCTQRS
TLEHAQSFVNSLLLSLENHAIFASLNVKAVKFWDILLWVDANDYIGILLGDEEESNEVTI
KLGTSNFIKGENYRNLLKQTLIGYLVLVARNVRSTNDVKEQQQYRLNLVRNEVTEQMFDF
LNNLSSSVDIRENTDLRDSIILIVKGISHFIGLDCTVYESVAKLRYQLLRMLDVDDSSHD
DTWQSLNVSCTLTQLFCSVCCQSNDLDVCQSEAWICPSCGKQFHSSTIEQLLIERVNQLL
IAYTIQDFKCTRCEAVRRHNLSLFCDCCGVEENVISPAELRFNLETVGKIAQQHNLTRLA
ELCGWTLF
NT seq 6867 nt   +upstreamnt  +downstreamnt
atggctttgactcttggtttgcttgaaactttcttggcggggaaaaatcggatttcatct
gagactatttatttctacgtatgtatttccgattatgaattctgctcctcattaaatgaa
ttacgaccatttagtaatattcttaaacttgattctagctatggttctcgtctacaaaaa
attcgctcgtcggaaattctggatcagaaatttggtttccagcgttacactgacatagaa
tggaagaatgcttggttgttgaatgttcagtcggcggaaatgatagatgagcaaacgaaa
aatatcattgcagtgtgcgacttttatttccttgaagaagatggaggacgttttaagata
tcatatccatttcgtccatatctctatattgcaactcttccttcatttgaacatcaggtc
ctgtcatatttatcgaaaaaatacacgagtgtaattactaccgatattgtggaaaaggaa
gatcttgatctaaaaaatcacctcgcaggattgaaacgaacatatttgaagatttcattt
ccaagtttaagcgaacttctgaagttcaagaaagatatcatgccaatactaagaaggaat
caggaaagagagaaacaaacaacttcgtatactaatcttcttacaagacattttggacca
cgggaagtgctgttcgatgaaggtggtgttttagaaaaaattattgacttgagggaacat
gatttgccttaccaaatgagagtgtgcattgacatggaagtattcgtaggtctttggtat
cgtgtaacaggacgagattttgatcgaaggccaaaaataactcgtcatccaacactgatc
gatccaccagaaccaattattttagcttatgatattgaagttacaaaactacctttgaaa
tttccggacagcacttttgatgaaatcatgatgatttcgtatatggtcaatggaaatggt
ttcttaattattaataggcagattatttccacagatgttgatgattttgagtatactcca
aaaccggagtataagggaatattccgggttatcaatttgcctgacgaaaaagccgttatc
aaatatttttttgaccatatcattcgacttcgtccgtctgtattcgtcacttataacggc
gattcattcgattggcctttcgtggaagctcgtgctgctgtgcatggtttgaatatgcta
acggaaattggtgtttctaaaaattcttctggagagtacagaactacaaatgcagtccac
cttgatgcattcagatgggtgaaacgtgatagttacctgccagtgggaagtcaaaatcta
aaatcttgtactaaagctaaacttcgatatgatccagttgagcttgatcctgaagagatg
tgtgcaatggccaaagatgaacctcaaacactggcaaactattcagtatctgatgcagtt
gcaacatattatttatacattaaatatgtccatccgttcatctttgcgctgtgtacaatt
atacctttgggtcccgatgatgtacttcgcaaaggttccggcacattatgtgaagcactt
ctgatggttaaagcattccataacaatatcattttcccgaataaatccttgccctatggc
gcaaaatatgccagtgatggacatgtgattgaaagtgaaacatatgttggaggctatgtt
gaagctttggaatctggtgttttccgtgccgatattccagaaaaatttcgaatcgtcccg
gccgcaatcctagatttaaaacgaaatgttagaaaaacactaagtgattcactaactcat
gaatttggtgttaacatggatgaagtacttcgcaaaggttccggcacattatgtgaagca
cttctgatggttaaagcattccataacaatatcattttcccgaataaatccttgccctat
ggcgcaaaatatgccagtgatggacatgtgattgaaagtgaaacatatgttggaggctat
gttgaagctttggaatctggtgttttccgtgccgatattccagaaaaatttcgaatcgtc
ccggccgcaatcctagatttaaaacgaaatgttagaaaaacactaagtgattcactaact
catgaatttggtgttaacatggatgaagttgttaatttcgacagtgttgtaagtaagatt
gaaacacagcttgatgacttcattaaaagacctctgcgcctcgaaactcctaagatttac
catttggatgtgggtgcaatgtatcctaatattatactaaccaatcgtcttcagccatca
gcagttgttacaaatgaagattgcattgcttgtgtgtacaattcaccggatgcgaagtgt
cggagaacgatgcgatgggagtggcgcggtgaaatcatgcctgcttcaagaggggaatat
gagcgcattctgcagcaactggaaaatgaaacatttggtaaaccaccaagagcatttcat
agcttagatcatgatcaaaggattcaaattgaaataaagcgagtaaaagatttttgcaag
cgcgcatacggtaaaactcacattacaaagaatgaatatcgatatacgacaatttgtcaa
cgagaaaatgcattttatgtggataccgttaaagctttccgcgataggcgatatgaatac
aaagcaatgcttaaaaaagctaaagctgttctagatgaagtatcggatgatgatattcat
gctttgaaaacagcccagggacgtgttgtcctctacgaaagtttgcagcttgcacataaa
tgcatcttaaactcattttatggatatgtcatgcggaaaggagcacgatggttttcaatg
gaaatggctggtatagtttgtcatactggtgcaaatattatcactgaagcacgaaagctt
gtggaacgtattggtaaacctttggaacttgatacggatggaatatggtgcctgattcca
gggacttttccggagaatattactttcactctaaacaattctaagcgtaaaacggtaact
atttcatatccgggtgcaattctcaatgcgctcatccatgataaatttacaaataaccaa
tttcaccaacttgaattggatggaacgtattctataacttccgaaaattccatatttttc
gaagttgatggaccatacttggcgatgattcttccagcttctagagaggagggtaaaagg
ctaaagaaaagatatgcagttttcaatttcgatggttcacttgctgagctaaaaggattt
gaagtaaaacgacgtggcgaattagcactgatcaagtacttccagagttcagttttcaaa
gcattcctaaaaggcaaaaatcatccagaagcatatgagcatgctgcaaaggaagccaat
tactggctggatgtactgttctcgaaaggtgctaccataccagattacgaattatttgat
ttaattgccgaaaatcggagtatgtcaaaaaagcttgatgattatggtgaacaaaaatca
acgtctatttcaaccgcgaaacgccttgcagaatttcttggtgatgatatggttaaagat
gttggacttgcttgccgttttattatttcgaagatgccacttgatgcacctgtcgcacaa
agagctattcccttggctatattccaagcagcaccaaatgtctctgctcattatcttcga
aaatggactaaagatacaacaattactaaagataatatcaatatccgaaatattatcgac
tgggaatattatattgagcgctttggagctaccattcagaaaattatctcaatcccggct
gctctacagaatgtacctaatccagtcccacgcgttccgtttccggactggttggagaac
aagcgacaacagcgaaaaaatgatcacaaacagccgaaaatcaatgaaattttcaaaaag
gccactaccttggcttttacacctgatattgagaatattaacagttcaagagctgcgagt
aatagctcgttgaataatgttactcttctcagtaactccccaaattcagagaaggactct
tccacaacaacgacgtgtgtctttttgaatgttgctgcgaagcaatcacagagttcatca
ttaaccaaaataaccgatcgatgggagcgatttctccgaatcttgatgatgaaaacagta
aaggatgtaattggatttcagtcgtcaaactttgtaactaagagaacatatttgaaagcg
aagtggcaaaaagaaagggcagaaaaaaaccgcagaaaacaaaatgctttgtctaaagga
attacaccaattatgtcaatgcttgaacgtggtaaacagatgatgcgagatactgcgtgg
caaattgttaagatatcagaaactccaagcaaaggtatgttagcattatggtgtataatt
cttgataaaatgatgaaaatcaatttacgaatgccgcggatcatttatgtgaataatcgt
gaagaaaatgggaattccggcatactagtgaaacgcattcttccacgcttaaagccagtt
tttaatttacggcaatatgttatcgatgaaaggatatttgaatcgagtttaaatcagttg
aacaaagaattgtgtgcgatgagaattgaaggtgtttatgagtcacaggtaccacttctc
ttccgtgccttgcttacctttggctgtagctgtcgattaaaaccgaatttgcaaacaaat
tcgactgccacatatgatttcgaacagcttgaaccggatttctcggtgcaatatcttccg
gaaaacagtgttcgcactttgttcttttatgaacatcaacaggacaatcgatgtgttata
gcagtgttcaatacagccacgagcgaagcgcacatcgttgtggtgaacaaaactgaatta
aatttaccgaatttatcaaatatgtatgccagtgaaaaagcaaatttgtcggctgatgtt
attgtttcttttttgagccgcaaggctgatatgaattttactgtaagtcagtgctctgct
gtccaaagggctgaccgaataattcagcgatatattcgaagtttacttcatgttgatagt
tacccgacagtgattgctgtgcaatcgaggcagcagttgtcagcattagtcaagcgatta
ccagcgctcgatagctatcctcttgtgcgaattcatgcttccgagccatccggtcttttc
aacgttttggattggcaacgtattgtcctgagaagaatcatcaagcattatttcaatatg
tttttatatttgcatcaatatgtagaagtgagccgttatttgcatattccaatcggtaat
ataccggaagatttctcaacatttggtccagatgtattgtttgcacgaagtttgattaat
caaggatacgttttgtgggcatcaccacttagccgaccggatcttggcggtaaagaactg
gatgatactcgtctaaatgctgtttggtcatcactttccattaataagcaatcagtttgt
gtggtcaacgaatccagcttcgaaaccgatgtatgtattgagctagaattgggcgcagtt
gatgttacagcaattgtgcaatcagcaagtatcgctgatgcggaaggtggtgcagattca
gtcgggtttttgactggatctgttttgtcggcagatgcgctccttggatatgtccgaagt
attgcccagtatgatgaaggagcagctgtagcaggtccattaaaagtcctccggctgcta
ttgcatgactgcattaaggatattcacttgtatggtagtaaaattgcggatcaagtaatt
attagccttgatcgctggttacgcacacagcattcattgatgtatgatcctgcaattgtt
cgcgtagtcgatatactaatcactaagctaatcctcttgctggttgctgaactaaatcgt
ttgggtggacgtgttatttatgcatctagttcacaacttattatgtgcacgcaacgttcg
actcttgaacatgcgcagtcgtttgtgaatagtttgctcctatcacttgaaaaccacgca
atttttgcatcactaaatgttaaagcagttaaattttgggatattctgttatgggttgat
gcgaatgattatatcggaattcttttgggtgatgaagaagaaagcaacgaagtcactatc
aaacttggtacctctaattttattaaaggagaaaattatcggaatttgctcaaacagaca
ttgatcggataccttgttttagtagctcggaatgtaagatcaactaatgatgtgaaggaa
cagcaacagtatcgcttaaatcttgtaaggaatgaagttacggaacaaatgtttgatttt
cttaacaatttatcatcaagtgttgatatccgggagaacactgatttgcgggattcaatt
attttaatagtgaaaggaatatcgcatttcattggactagactgtactgtctacgaatcg
gttgcaaagctgcgctatcaacttctgcgtatgttggatgtggatgattcatcacatgac
gatacatggcaatcgttaaacgtttcctgcactttgactcaactgttttgttctgtatgc
tgccaatcaaatgatttggatgtatgtcaatcagaagcatggatttgtccaagctgtgga
aaacagttccattcgtctaccattgaacagctcctaatagaacgagtgaatcagcttctg
atagcttatacaatacaagatttcaagtgtacgcgttgcgaagcggttcgaagacataat
ctgtctttattttgtgattgttgtggtgttgaagaaaacgttatatcacctgccgaactt
cgtttcaacctggagacggtcgggaaaattgctcagcaacataaccttacacgtttagct
gaattgtgtggatggactctgttttga

KEGG   Loa loa (eye worm): LOAG_18179
Entry
LOAG_18179        CDS       T02664                                 

Name
(RefSeq) DNA polymerase epsilon subunit 2
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_18179
   03410 Base excision repair
    LOAG_18179
   03420 Nucleotide excision repair
    LOAG_18179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_18179
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_18179
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     LOAG_18179
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    LOAG_18179
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      LOAG_18179
SSDB
Motif
Pfam: DNA_pol_E_B
Other DBs
NCBI-GeneID: 9951574
NCBI-ProteinID: XP_020305426
AA seq 347 aa
MLTQRNPGVYEIEDLTGAIEVDLKESTFHKGLFTDGCIMMLEGRSIGGVFRVSAVGLAPI
ESAKMTRNYFGITNWFGGKGTVACGSQIRLRTLCERNDRARFILMSDVWLDDSRILNAIN
ELIFAFTDSQLLAFIICGNFCSQVGTADAYHRIYDGFSHLAAILQKDVLADRNVHFIFIP
GPDDPSLNSILPRPPLPFELFELMKDVPNCSFASNPCRIQYTNQEIVIMRHDLVEKMCRN
SIHMPSTTADIPEHFCHTVASVGHLSPLPLHISPVIWQMDSYLTLYPLPDLVVIADKFEH
FHYQLEGTLFVNPGSFARTDLNFYVYYPALRIVEVCSADRKATGGPE
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgttaactcaaaggaatcctggcgtttatgaaatcgaggatcttacgggtgctatagaa
gtcgatcttaaagaatcaaccttccacaaaggtctttttaccgatggctgtataatgatg
ttggagggccgatctattggtggtgtatttcgtgttagtgctgttggtcttgcaccaatt
gaaagtgccaagatgacaagaaattactttggaataacgaattggtttggtggtaagggt
accgttgcctgtgggtcgcagattcgacttcgtacactatgcgaacgaaatgatagagca
aggttcatccttatgtcagatgtatggctggatgattcaaggatattgaatgcaatcaac
gaacttatatttgctttcacagattcccagctgcttgcattcattatatgtggtaatttt
tgttctcaggtgggtacagctgacgcatatcatcgcatttatgatggatttagccacttg
gcagctattttgcaaaaagatgtattagctgatcgtaatgttcactttatattcattcct
ggtccagatgatccatcgctaaattctatacttccacggccaccgttaccatttgaactt
tttgaactgatgaaagatgtacctaattgttcgtttgcatcaaacccatgccgtatacaa
tacaccaatcaagaaattgtcatcatgcgtcatgatttggtcgaaaaaatgtgcagaaat
agtattcatatgccgtcgaccactgcggacattccagaacacttctgtcatacagtcgct
tcggttggtcacttatcgccactaccgctgcatatatcacctgttatttggcaaatggat
agctaccttacattgtacccattaccggatcttgttgtcatcgcggacaaattcgaacat
ttccattaccaattagaaggcactcttttcgttaatccagggtcatttgctcgtactgac
ctcaatttttatgtatattatccagcgttgcgtattgtcgaggtatgttctgctgatcgg
aaagctactggaggtcctgaataa

DBGET integrated database retrieval system