KEGG   Loa loa (eye worm): LOAG_09579
Entry
LOAG_09579        CDS       T02664                                 

Name
(RefSeq) NOT2/NOT3/NOT5 family protein
  KO
K12605  CCR4-NOT transcription complex subunit 2
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_09579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_09579
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_09579
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_09579
SSDB
Motif
Pfam: NOT2_3_5
Other DBs
NCBI-GeneID: 9947020
NCBI-ProteinID: XP_020301849
AA seq 222 aa
MGGPSEIMSGLCGIVDGPSGIVGEPSGITSRPSGITSGPSGIVMPTSGPSSLQMGNPNVG
VIPRSGLHFFRGLQPEPRMNIQMYPDGTVTNIPPTMVADQFGMIGFLSAHRGMQFDPKLA
TLTVGEDPVNMGLGMNSNLEVPDSNGRGRHGREWRYHKVERAWVKRLNFGSIVERTTTFE
RGVYNVFDPIFWRKMPREMTLHYEDLERKPTIPPDMRAFFDR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgggcggcccaagtgaaattatgagcggcctatgtggaattgtggacggcccaagtgga
attgtgggcgagccaagtggaattacgagcaggccaagtggaattacgagcgggccaagt
ggaattgtgatgccaacatcaggaccttcatctttgcagatgggtaacccaaatgttgga
gtcattcctaggtctggactgcatttcttccgaggtttgcaacctgaaccgagaatgaac
atacagatgtatccagatggtacagtgactaatattccaccaactatggtggctgaccag
tttggaatgattggattcttatctgctcatcgtggaatgcagtttgatcctaaacttgca
acacttactgttggtgaagatccagtaaatatgggtttgggtatgaactctaaccttgaa
gtaccggactcaaatggacgtggcaggcacggaagggagtggcgttatcacaaagtggaa
cgtgcctgggtgaaacgtttgaatttcggaagtatcgttgaacgtacaactacatttgaa
agaggggtatataatgtgttcgatccaatcttttggaggaaaatgccgagggaaatgaca
ttgcattacgaagatcttgaaagaaagccaacaataccaccagatatgagggcgttcttt
gatcgataa

KEGG   Loa loa (eye worm): LOAG_16933
Entry
LOAG_16933        CDS       T02664                                 

Name
(RefSeq) CCR4-NOT transcription complex subunit 2
  KO
K12605  CCR4-NOT transcription complex subunit 2
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_16933
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_16933
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_16933
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_16933
SSDB
Motif
Pfam: NOT2_3_5
Other DBs
NCBI-GeneID: 9942073
NCBI-ProteinID: XP_020306872
AA seq 377 aa
MSSSGGVLADRNRLSSQSSASSACRNSLIPPENVINESEFPSLVVRSSPSSTSSAFNSLP
TTSNYSSSPPVPQNHLYSKDVYNALQRAPYANLMRTSDGNSLPTQNVEFRIQNEDFPALP
GANHLENRQTHVRTANNADALASETKYSERSNTETKTGIQTFPDGTVKNIPVGMLSDQFG
MAGLLTFLRAIESDPAIVALALGHDLTTLGLNLNSTERNIYATFGGPWADYPCRIQDLEA
KVPDEYLTNASIRDKLPNIKLSKLSEDVLFYLFYNCPGEVYQVAAASELYSRDWRFHKGQ
RVWLTRSQYGGVKEQTSTYEKGSYNVFDPVQWRKIPRDMTLEYKELEERPKLPQSLQQSG
QPQVAQSPSTATSQNGS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgagcagtagtggaggtgtattggctgaccgtaatcgactttcatcgcagtcttcagca
tcatcagcttgtcgtaattcgttaattcctccggaaaacgttatcaacgagtcagaattc
ccatccctagtagtacgctcctcaccctcctcaacgtcctctgcatttaattccttgccg
accaccagtaattactcctcctcaccacctgtaccacagaatcatctttattcaaaagac
gtctacaatgctctacaacgagccccttacgcgaatttgatgcgaacaagtgatgggaat
tcgctaccgacacagaacgtcgagttccgtatccagaacgaggatttccctgcactacct
ggtgccaatcatctggagaataggcagactcatgtaaggactgcgaacaacgccgatgca
cttgcctcagaaacaaagtactccgaaaggtcgaacactgagacgaaaacaggtattcag
acatttccggatggtacagtgaagaatatcccagtaggcatgttgagtgaccaatttggt
atggcaggactgttgacgtttttgcgtgcaattgaaagcgatcctgctattgttgcactt
gctcttggtcatgatttgacaactctgggcctgaatctgaactccactgagcgaaacatt
tatgcgacgtttggaggaccatgggcagattatccatgtcggatacaggatttggaggca
aaggtaccagatgaatatttaacgaatgcttcgattcgagataaactgccgaatatcaaa
ttgagcaagctatcggaggatgtgctgttctacctcttttataattgtccgggcgaggtt
tatcaggtcgccgctgctagtgagctgtatagtagggattggcggtttcataaaggtcag
cgtgtttggctaacgcgatcgcagtatggaggtgtcaaggagcagacatcaacgtatgaa
aaagggtcctacaatgttttcgatcctgtacagtggcgaaaaataccgagagacatgaca
ttggagtataaagagcttgaagaacgaccgaaattgcctcagtctttgcagcagtcaggt
cagccacaagttgcacaatcaccctctacagccacgtcgcaaaatggttcatag

DBGET integrated database retrieval system