KEGG   Loa loa (eye worm): LOAG_09879
Entry
LOAG_09879        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12584  m7GpppX diphosphatase [EC:3.6.1.59]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_09879
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_09879
Enzymes [BR:loa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.59  5'-(N7-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase
     LOAG_09879
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    Other 5'-3' decay factors
     LOAG_09879
   3'-5' decay
    Other 3'-5' decay factors
     LOAG_09879
SSDB
Motif
Pfam: DcpS_C DcpS
Other DBs
NCBI-GeneID: 9947319
NCBI-ProteinID: XP_003145454
UniProt: A0A1S0TR58
AA seq 314 aa
MDDSMTADGEKNAGNGTNDSLNLETFRFKEILGEDGARKVAFVLLDVNDCNDQAVLIVER
THFPLNEQDWNTIILQSSLKTLSTNDIYSNHILFPPEKFTGIKTTLINPCTEKHIAKYRN
QKRYVIHETPDDYKSITLPYLEKHQFTLKWIFNLLEYKAEVDRLIFDDADPQNGFVLAPD
IKWDGKNLANLYVLAIIRRKGIKSIRDLTASDLPLLENISQKSYMAIKEKYGIGKHQIRA
YFHYQPTFYHLHVHFIHVSYDAPASGVAMAYLLEDVINNIKLVPDYYQRSTLTFTVKENN
ELLKLYRTHIDNNI
NT seq 945 nt   +upstreamnt  +downstreamnt
atggatgactctatgacagctgatggagaaaaaaacgccggcaatggtacgaatgattct
cttaacctggaaacttttagatttaaggaaatacttggtgaagatggtgcccgtaaggta
gctttcgtactattggatgtgaacgactgtaatgatcaagctgttctgattgtggaaagg
actcattttcctctgaatgagcaggactggaacacaattattttgcaaagttcactgaaa
acattatcaactaatgacatatattcaaatcatattttattcccaccagagaagtttact
ggaatcaagacgacgttaataaatccatgtaccgaaaagcatattgcgaagtatcggaat
cagaaacgatatgttattcatgaaacgccggatgattataagtccatcactttaccttat
ctggaaaaacatcaattcacactgaagtggatttttaatttgttggaatacaaagccgaa
gtagaccgtcttattttcgatgatgcagatccacagaatggttttgtgcttgcgccagac
atcaaatgggatggcaaaaatttggcgaatctttatgttttggcaatcatcaggcggaaa
gggatcaaatccattcgggatttaactgccagtgaccttccactactagagaatatttct
cagaaaagttatatggcaattaaagagaaatatggaattggtaaacatcagatccgagct
tattttcactatcagccaacattctatcatttacatgttcatttcatccatgtatcatac
gatgcacctgccagtggcgttgcaatggcctatcttctggaggatgtaatcaacaacata
aaattggttcccgattactatcagcgttctacgttgacttttacggtgaaggagaacaac
gaactgctgaagttatatcgcacgcatatcgataataacatctaa

DBGET integrated database retrieval system