KEGG   Loa loa (eye worm): LOAG_10075
Entry
LOAG_10075        CDS       T02664                                 

Name
(RefSeq) U6 snRNA-associated Sm-like protein LSm2
  KO
K12621  U6 snRNA-associated Sm-like protein LSm2
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
loa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LOAG_10075
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_10075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_10075
   03041 Spliceosome [BR:loa03041]
    LOAG_10075
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_10075
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     LOAG_10075
Spliceosome [BR:loa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    LOAG_10075
 Complex C
  U2 snRNP components
    LOAG_10075
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 9947516
NCBI-ProteinID: XP_020301743
AA seq 99 aa
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNMKLTDISVTDSERYPHMLSVKNC
FIRGSVVRYVQLPADQVDTQLLQDASRKEVMQSKRSATA
NT seq 300 nt   +upstreamnt  +downstreamnt
atgctattttattcattcttcaaatcactggttgggaaagatgtggtagtggaattgaaa
aacgacctgagtatctgcggtacgttgcattcggtggatcagtacttaaacatgaaactg
acagatatctcagtgactgattcggaacgatatccgcatatgctttccgtcaaaaactgc
ttcattcgtggatctgtggtacgatacgtgcaactacctgctgatcaagtggatactcaa
ttgttgcaggacgccagtcgaaaagaagttatgcaatccaaaagatccgctactgcctaa

DBGET integrated database retrieval system