KEGG   Loa loa (eye worm): LOAG_10180
Entry
LOAG_10180        CDS       T02664                                 

Name
(RefSeq) nuclear DNA-binding protein C1D
  KO
K12592  exosome complex protein LRP1
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_10180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_10180
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     LOAG_10180
SSDB
Motif
Pfam: Sas10_Utp3
Other DBs
NCBI-GeneID: 9947624
NCBI-ProteinID: XP_003145755
UniProt: A0A1S0TQY0
AA seq 204 aa
MSDSIPPEVVEQLRRFNEALTVLEDTYQKHFSNSLEANTQRPPLEKLEIDLMSVFVINSL
YWMLLCTHGQKPKDNELLQNEINRTKEYMGRLKQLEERKTAPCLNQRAARSFVRNALWEP
KQQQRSDTSDHSCEEDVNKRDERYEMESGDCSISLKETEFGEDQMEEEDVALVNSNTVKS
ATKRLPREANIMMAGGTLPKKKRL
NT seq 617 nt   +upstreamnt  +downstreamnt
tgatgagcgattcgataccaccagaagttgttgaacagttgcggaggttcaatgaagcat
taacagttctcgaagatacttaccagaaacatttttcgaattccttggaagcgaataccc
agaggccaccactagaaaagttagaaattgatttgatgtccgtgttcgtgattaattcgc
tgtactggatgctgctctgcacacatggacaaaaaccaaaggataacgagcttctgcaaa
atgaaattaaccgaacgaaagaatatatgggacggctgaaacagctagaagaacgaaaaa
cagcaccttgtttgaatcagcgggcagcgagaagttttgtgcgaaatgctttgtgggaac
cgaagcagcaacagcgatcagacacatctgatcactcctgtgaggaagatgtgaataaga
gagatgaacgatatgaaatggaaagtggtgattgttcgatttcgttgaaagagactgaat
ttggagaagatcagatggaagaagaagatgtagcccttgtaaattcaaatacagtgaaaa
gtgctacgaaacgattacctcgggaagcaaatattatgatggcaggaggtactcttccaa
aaaagaagcggttgtaa

DBGET integrated database retrieval system