KEGG   Loa loa (eye worm): LOAG_10202
Entry
LOAG_10202        CDS       T02664                                 

Name
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
loa  Loa loa (eye worm)
Pathway
loa03030  DNA replication
loa03410  Base excision repair
loa03420  Nucleotide excision repair
loa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LOAG_10202
   03410 Base excision repair
    LOAG_10202
   03420 Nucleotide excision repair
    LOAG_10202
   03430 Mismatch repair
    LOAG_10202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:loa03032]
    LOAG_10202
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_10202
DNA replication proteins [BR:loa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    LOAG_10202
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LOAG_10202
   MMR (mismatch excision repair)
    Other MMR factors
     LOAG_10202
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    LOAG_10202
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Hus1 p25-alpha
Other DBs
NCBI-GeneID: 9947646
NCBI-ProteinID: XP_020301722
AA seq 263 aa
MFEAKLGSASTLKRIVDAIKDLVTDAPFDCSETAMCLQAMDSSHVALVSLKMDVAMFESY
RCDRTINLGLSLAGMARALKCANNEDTCLIRYEENDDSVLFLFEDTKRDKSQEVVVKMMD
IDSEHLGIPEQDYSAVVCMPAAEFQKTCRDLAMFSDSLMITVTKAGIVFTGKGDTGSSTV
TYAPSKNADEEEQAVSVNVKEPVTVNFSIKYMNHFTKATGLSDRVRLSLCNSVPVVVEYE
LSENGHLRFYLAPKIDDEDADMK
NT seq 792 nt   +upstreamnt  +downstreamnt
atgttcgaagcaaagcttggtagtgcttcgacactgaagagaattgtagatgctatcaaa
gatcttgtcacagatgcaccctttgattgcagtgagactgctatgtgcttacaggcaatg
gattcatcgcatgttgcattggtgtcattgaaaatggatgttgcaatgttcgaaagctat
cgttgtgatcgaaccattaaccttggtcttagcttagcaggtatggcaagagcgctaaaa
tgtgcaaataacgaagatacatgcttgattcgatatgaagaaaacgatgattcggtgcta
ttcctcttcgaggatacgaaacgggataaaagtcaggaagtggtcgttaaaatgatggat
attgatagtgagcatcttggcatcccggaacaggattattctgctgttgtttgtatgcca
gctgctgaattccagaaaacttgccgtgacttggctatgttctctgactccctgatgata
acagtaaccaaggcaggtattgtcttcaccggtaagggtgataccggctcatctacagtt
acttatgctccttcaaaaaatgccgacgaagaggaacaggctgtatcagtgaacgtaaag
gagcctgttacagttaatttttccatcaaatacatgaatcatttcacgaaggctacagga
ctttctgaccgagttcgtctttctttatgcaatagtgtacctgtggtagtagagtatgaa
cttagtgaaaacggacacttgcgcttttatctggctccaaaaatagacgatgaggacgca
gacatgaagtaa

DBGET integrated database retrieval system