KEGG   Loa loa (eye worm): LOAG_10674
Entry
LOAG_10674        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_10674
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:loa01002]
    LOAG_10674
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_10674
Enzymes [BR:loa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     LOAG_10674
Peptidases and inhibitors [BR:loa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   LOAG_10674
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOAG_10674
SSDB
Motif
Pfam: Trypsin Peptidase_S6
Other DBs
NCBI-GeneID: 9948122
NCBI-ProteinID: XP_003146246
AA seq 132 aa
MFQRIPYNSIYLFTGWGFQEESGSFSSKLRETHVPIIPIVICNSILHYFGRVDPLSMLCA
GSGGADACQGDSGGPLMCYSRMRQRWELQGVVSWGHGCGRNNIPGVYAKISAVTSWVNSQ
MKLLQLNDNDIL
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtttcaaagaattccgtataactcgatatatctttttacaggatggggcttccaagaa
gaaagtggtagtttttcatcaaagttacgtgaaacacacgttccaatcataccaatcgtt
atttgcaatagtattttacattatttcggtcgtgtagatccgttatccatgctctgtgcc
ggttccggtggtgctgatgcttgtcagggtgattcaggtggtccactgatgtgttatagc
cgtatgcgtcaacgttgggaactacagggagtggtcagttggggtcatggatgtggtcga
aacaatattcccggagtgtatgctaaaattagtgctgttactagttgggtgaattcgcag
atgaaattactacaactaaatgataatgatattctctag

DBGET integrated database retrieval system