KEGG   Loa loa (eye worm): LOAG_12866
Entry
LOAG_12866        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12586  exosome complex component RRP43
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_12866
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_12866
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_12866
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 9950331
NCBI-ProteinID: XP_003148426
UniProt: A0A1I7VCH3
AA seq 276 aa
MTADLLKLCDPAAYYNQFLSESIYPDGRSISRFRPIMLRMGVNGRSAGSSFARQGGATVT
CNIEALLAPVSDAPIIMPIIQAAPNIPKNLVEDAMVMVNQLVAQNAFCTKDALKTAGGRL
TWLLNLHIMILNVDGAICDALCTCIAGALVDLRLPDVCTDCEEDIPIDINKVKLSETFHH
IEIVDIPVSSTFIVYEPPNEEVKILCDPVSELFRVAPNTVMIVVGNNARIHRISQSGICG
DENTMRHMVEMAVGRQKVVAESMLKAKEAHLMREKE
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacagctgatctgttaaaattatgtgacccagcagcttattataatcaattcttatcg
gaatcaatttatccagatggtcggtcaattagtcgctttcggccaataatgctacggatg
ggtgttaacggacgatcagcgggttccagttttgctcgacaaggcggggcaactgttaca
tgtaatattgaagcattgttggcacccgtttcggatgctcccattattatgcccattata
caggctgctccaaatataccaaaaaatttggtcgaagatgcaatggttatggtcaatcaa
cttgtggcacaaaatgccttctgcacgaaagatgcattgaaaacggcgggtggacggcta
acatggcttcttaatttacatatcatgattttaaacgttgacggggctatatgtgatgcc
ttatgtacatgtatagctggagcattggttgacttgcggcttcccgatgtttgtactgat
tgtgaagaagatatccctattgatatcaacaaagttaaactcagcgagacatttcatcac
atcgaaattgtggatattccggtttcatcgacatttatcgtttatgaaccaccaaatgaa
gaggtgaaaattctttgtgacccagtgtccgaattatttcgggtagctcctaacacagta
atgatagtagttggaaataatgctcgaatccatcgtataagtcaatcaggcatatgcggt
gatgaaaatacgatgcgacatatggttgagatggccgttggacggcagaaagtagtagct
gaatcgatgcttaaagctaaagaggcccacttaatgagagaaaaggaataa

DBGET integrated database retrieval system