KEGG   Loa loa (eye worm): LOAG_16336
Entry
LOAG_16336        CDS       T02664                                 

Name
(RefSeq) chaperone DnaK
  KO
K04043  molecular chaperone DnaK
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
loa04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_16336
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_16336
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_16336
   03110 Chaperones and folding catalysts [BR:loa03110]
    LOAG_16336
   03029 Mitochondrial biogenesis [BR:loa03029]
    LOAG_16336
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_16336
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     LOAG_16336
Chaperones and folding catalysts [BR:loa03110]
 Heat shock proteins
  HSP70 / DNAK
   LOAG_16336
Mitochondrial biogenesis [BR:loa03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    LOAG_16336
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    LOAG_16336
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LOAG_16336
  Exosomal proteins of breast cancer cells
   LOAG_16336
  Exosomal proteins of colorectal cancer cells
   LOAG_16336
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA Tn7_Tnp_TnsA_C
Other DBs
NCBI-GeneID: 9937425
NCBI-ProteinID: XP_020307530
AA seq 768 aa
MSLLYNRATTQFNEIRTEKRYFSAVAVGRNLGGCYRRLDYAQVGFWCSGCVEGWGIFVYR
LLHTVYWVVPVSPKAIRNWFCFGNVTHYNLTQVERSRTRMIFSAIRTVVSATCSRTLYVR
PTDSILLGVTRRYKSDGVKGTVIGIDLGTTNSCVAVMEGKQAKVIENAEGVRTTPSVIAF
TKDGERLVGAPAKRQAVTNSQNTLYATKRLIGRRFDDPEVQKDVKVVPFKIVRASNGDAW
VEAQGKMYSPSQVGAYILMKMKETAESYLGTTVHNAVVTVPAYFNDSQRQATKDAGRIAG
LNVLRVINEPTAAALSYGLDKAEDKIIAVYDLGGGTFDISVLEIQKGVFEVKSTNGDTFL
GGEDFDNALVHYLAAEFKKDSGIDIHKDPMAMQRLREAAEKAKCELSSTTQTDINLPYLT
MDASGPKHMNLKLTRAKFEQLVADLIKRTIEPCRKAMHDAEVKPSEIGEILLVGGMTRMP
KVQQTVQEVFGKQPSKAVNPDEAVAIGAAIQGAVLAGDVTDVLLLDVTPLSLGIETLGGV
MTKLIQRNTTIPTKKSQVFSTAADGQTQVEIKVYQGERDMATNNKLLGQFSLVGIPPAPR
GVPQIEVTFDIDANGIVNVSARDRGTGKEQQIVIRSSGGLSKDQIENMIREAEKNAAADA
ERKEKVEVCNQAESVIQDTDSKLTEFKDQVDAKEAEAIRNKLGELRQLLANKDNETTANI
REAIGSLQQQSLKLFEAVYKKMAAENTQSSSGAQEAQTAEEPKKEESK
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtccctcctatacaaccgagcaaccactcagttcaatgaaatacgaacggagaaacga
tattttagtgctgtagcagttggcaggaacctcggagggtgctaccgtaggttagattat
gcacaggtgggattttggtgtagcgggtgtgttgaaggttgggggattttcgtttacaga
cttctccatacagtttattgggttgtcccagtatccccgaaagctatcagaaactggttc
tgttttggtaatgtgacacattataatcttacacaggtagaaagaagcagaacaagaatg
atcttctcagcgatccgaacagtagtgtcggctacatgcagtcgaacattgtatgtgcga
cccacagatagcattctattaggtgtgactcgccgatacaagtccgatggtgtcaaggga
acagttattggcatcgaccttgggacaaccaattcgtgtgttgcagttatggaagggaaa
caagccaaagttattgaaaatgcggaaggtgtgaggacgacgccatcagtgattgcgttt
accaaagatggcgaaaggttagttggcgcaccagcaaaacgacaagcggttacaaattca
cagaatacactttacgctactaaacggttgattggacgacgtttcgatgatccggaagta
caaaaggatgtgaaagtggttccatttaaaattgttcgtgcatccaatggtgatgcctgg
gttgaagcacaaggcaaaatgtattcgccatctcaggtcggtgcatacattctgatgaaa
atgaaagaaacagcagaaagttatttgggcacaactgttcacaatgctgttgtcacagtt
ccggcttacttcaatgattctcagagacaggcgacaaaagatgctggtagaattgctggt
ttgaatgtactgcgtgtcattaacgagcccactgcggcagctctgtcttatggacttgat
aaagcggaagacaaaatcatcgctgtgtatgatttgggtggcggtacattcgacatatct
gtccttgaaatccagaaaggggttttcgaagtgaagtcgactaatggtgatacattcctt
ggtggtgaagattttgataatgcattggttcattatcttgcagcggaattcaagaaagat
tctggcattgacattcataaggatcctatggcaatgcaacgtttgcgagaagctgccgaa
aaagcgaaatgcgaattatcatcgacaacacaaactgatataaacttaccatacttgacg
atggatgcctctggcccaaaacacatgaatttgaagttaacgcgtgctaagtttgaacag
ctagtggctgatctcataaagcgaactatcgagccctgtcgcaaagctatgcatgatgca
gaggttaaaccgtccgaaattggagagattttacttgttggaggcatgactaggatgcca
aaagtccaacaaacggtacaagaagtatttggtaagcaaccttcaaaagcagtgaaccct
gatgaggcggtagcgatcggagcggcaatccaaggtgcggtgttggcgggcgatgtgact
gatgttctcctactcgatgttacaccactttcgttgggtatcgaaacattgggtggggta
atgaccaaacttatccaacgcaacacaaccattcctacaaagaaaagccaggtattctct
acagcagcagatggccagacacaagtagaaatcaaagtttaccaaggggaacgtgacatg
gcaaccaataacaaacttttaggacagttttcattggttggaataccaccagctccacgt
ggcgtaccacaaatcgaagttacttttgatatagatgcgaatggtattgttaacgtatca
gcaagagatcgaggaaccggcaaggaacagcaaattgttattcggtcttctggtggatta
tcaaaagatcagattgaaaacatgattcgtgaagcagaaaagaatgccgccgcggatgct
gaaagaaaagagaaggttgaagtttgtaatcaagcagaaagtgttatccaggataccgat
tctaagttaactgaatttaaagatcaagtggatgcgaaagaggctgaagcaattcgtaat
aaacttggtgaactgaggcagctcttggcgaataaggataacgaaacgacagctaacata
cgtgaagcaatcggttcgctgcaacagcagtcactgaaattatttgaggccgtctacaag
aaaatggcagcggaaaatacgcagtcctcaagcggagcacaagaagctcagacagcagaa
gagcccaaaaaagaagaaagcaaatga

DBGET integrated database retrieval system