KEGG   Loa loa (eye worm): LOAG_16817
Entry
LOAG_16817        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_16817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_16817
Enzymes [BR:loa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     LOAG_16817
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LOAG_16817
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LOAG_16817
SSDB
Motif
Pfam: OGG_N HhH-GPD FliG_C HHH_2 HHH HHH_5
Other DBs
NCBI-GeneID: 9948060
NCBI-ProteinID: XP_020306995
AA seq 312 aa
MPLLKCSKEELNLGAVLLSGQSFRWKKLVTNVDENIAPSSDDIFFGVAKHRVWKVWREND
EQLGYELGIELIPLYKLWSENDKHFARLLANHRTKLEGIRVLGQDPLETVFAFICSANNH
IRRITNMVETLCELYGESTNVSCLNGIKTFYDFADLKRMTDDPSLETVLRTRGFGYRALN
IALASKALQDNGEQFLENLSKGTYENAVEELQQMRGIGAKVADCICLMGLRMHFVVPIDT
HTLQITAENYLGTLLQRKSLQEKDRRQVAAIWQEKFGPYAGWAQAVLFTAHLRQMNIRQP
TRRSLKIKTVKL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgccactactgaaatgctcgaaggaagaattgaatcttggggcagtgctgttaagcggc
caatcattcagatggaaaaaattggtaacaaatgttgatgaaaatatcgctccttcatca
gatgacatattttttggtgttgctaaacatcgagtgtggaaagtatggcgagagaatgac
gaacagttaggctacgaacttggtatcgaactaatcccactatataagctgtggtccgaa
aatgacaagcatttcgctcgtcttttggcgaatcatcggacgaaattggaaggaattcgt
gtccttggacaagatcctttggaaactgtttttgctttcatttgttctgcaaataatcac
atccgacgtatcacaaatatggttgagacactgtgtgagctatatggtgaaagcactaat
gtttcttgtttgaatggcattaagacattttatgattttgctgatctaaaacgcatgact
gatgacccttcgttagaaacagttttgcgaactcgtggttttggttatcgcgcactgaac
attgcacttgcctccaaagcactccaagacaacggggaacaatttctggaaaatttgtca
aagggtacttatgaaaatgcagtggaagaacttcagcaaatgcggggaattggcgcgaag
gttgcagactgcatatgtttaatgggactacgcatgcatttcgttgtaccaattgatacg
catacattacaaatcacagcagaaaattatttggggacattactgcaaagaaaatccctg
caagaaaaggatcgacggcaagttgcggctatttggcaagaaaagtttggtccatacgcc
ggttgggctcaagctgttttattcacagcacatctacgacaaatgaatatcagacagcct
acaaggagatcattaaagataaaaacagtaaagctataa

DBGET integrated database retrieval system