KEGG   Loa loa (eye worm): LOAG_17205
Entry
LOAG_17205        CDS       T02664                                 

Name
(RefSeq) G protein linked acetylcholine receptor isoform b
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
loa  Loa loa (eye worm)
Pathway
loa04020  Calcium signaling pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    LOAG_17205
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_17205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_17205
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    LOAG_17205
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 9948437
NCBI-ProteinID: XP_020306554
AA seq 578 aa
MISQSIFLQPSSLLHPVLHHIIKVRAVPGWCYRQAINVWIIVVTLSMETILGNAMVIAAY
KLERNISKQISNRFIVSLAVSDLIIGIEGYPLFTLYVLNGDHWPLGWIACETWLFLDYTL
CLVSILTVLLITADRYLSVCHTASYIKWQSPAKAQMTIICSWLIPALIFGFMIYGWSLVS
NTTSGLINGECVAPFLTNPYVNMSLYVVYYWTTLIAMLILYKGIHKVTKKLEKKAGAKDQ
RQLALLFSQQLGTQVGLKLMLSQTHNADSDTIEENVHIADAKDADYRTFTTNVTDSNERY
GLGNVDNLSIAMSEESADTIIFNNVAMFTSNSGIHQAYIHTATVSLDHAEEEFNQNSTAR
HALYCPSADARQKTLVSERFTMKWVSQIKNQVTRTLFNSKSSSSLSTTSSVEVSSSKAPA
TQSAGLNIPAVTRHGRTSRNENNSKQNFMTSTAFNGQRSRKLSFSSLNIKRDNVMQFFSP
FTLLRRKRKQTKAERRAHKAFRTITFIVGCFAILWSPYYVVATVYGFCRHCIPSLLYTLT
YYMCYLNSSSNPFAYALANRQFRVAFLRMLRRDFNKNS
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgatttctcagtctatatttctacaaccatcctcgcttcttcatccagtactccatcac
atcatcaaggttagagcggtaccaggttggtgttatcggcaagcgatcaatgtatggatt
attgtggttacattgagcatggaaacaattttgggcaatgcaatggttatcgctgcttat
aaacttgaacgaaatatcagtaaacagataagcaaccgtttcatagtatcattggctgta
tcagatttaattattggtattgaaggttacccattatttactctatatgttttgaatggc
gaccactggccactcggatggatagcatgtgaaacatggcttttccttgactatacactt
tgccttgtatcaatactgacggtgctgttgataacagctgaccgttatttatccgtttgt
catactgcatcatacatcaagtggcagtcacccgcaaaagcccaaatgacaattatctgt
tcttggcttattccggctcttatatttggctttatgatttatggctggtcactggtgtcc
aataccacgagcggacttatcaatggtgaatgtgtcgctccgtttctcaccaatccatat
gttaatatgagtttgtacgtggtttattattggacgacactgattgcaatgctcattctt
tacaaaggaatacacaaagttaccaagaaacttgaaaagaaagctggtgccaaggaccaa
cgtcagttggctctgttattcagtcagcaactagggactcaggttggtcttaaactgatg
ctttcgcaaacacacaatgcagacagtgatactattgaggaaaatgttcatattgcggat
gcaaaagatgctgattatcgaacgtttacgacaaatgttacagatagtaatgaaagatat
ggacttggaaatgtcgacaacctaagcatagcaatgagtgaggaaagtgctgatacaatt
atttttaataatgttgcgatgttcacaagcaattctggtattcatcaggcttatatccat
acagcgactgtctcattagatcatgccgaggaagagttcaaccagaattctactgctcgt
catgcattgtattgtccgtccgcagatgcaagacaaaaaacgcttgtcagtgaaagattt
acaatgaaatgggtatcacaaatcaaaaatcaagtgacgagaactttgttcaattccaaa
tcttcctcatcactttcaaccacgtcatcggtggaagtttcaagttcaaaagcgccggca
actcagtctgctgggctgaatatcccggctgtgacccgacatggaagaacctctagaaat
gagaacaattcgaaacaaaatttcatgacttcaacagcttttaacggtcaaagatcacgt
aaattatctttctcgagtttgaatattaaaagagataacgttatgcagtttttttcaccc
ttcactttacttcgacggaaacgtaagcagacgaaagctgaacgaagagcacataaagca
ttcaggacaattaccttcattgttgggtgttttgccatcctatggtcaccctattacgtt
gtggcaactgtatatggattttgtcggcactgtataccgtcactactgtacacactcact
tactacatgtgctatcttaattcgagtagcaatcctttcgcatatgctttggccaaccgc
cagtttcgtgtcgccttcttgcgtatgttgcgcagagacttcaataaaaattcctaa

DBGET integrated database retrieval system