KEGG   Loa loa (eye worm): LOAG_17508
Entry
LOAG_17508        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12622  U6 snRNA-associated Sm-like protein LSm3
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
loa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    LOAG_17508
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_17508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_17508
   03041 Spliceosome [BR:loa03041]
    LOAG_17508
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_17508
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     LOAG_17508
Spliceosome [BR:loa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    LOAG_17508
 Complex C
  U2 snRNP components
    LOAG_17508
SSDB
Motif
Pfam: LSM TIG_SUH LXG DUF4941 Peptidase_M16_M
Other DBs
NCBI-GeneID: 9941643
NCBI-ProteinID: XP_020306194
AA seq 103 aa
MTTEQGQTNVVSTGVEEPLDLIRLSLDERIYVKMRNDREVRGRLHAFDQHLNMILSQVEE
TVTTVELDEENFEEMHKQTKRQIPMLFVRGDAIILVAPPLRHT
NT seq 312 nt   +upstreamnt  +downstreamnt
atgacaacagagcagggacaaacaaatgtggtgagcacaggtgtagaagaaccattggat
ttaattcgattaagtttagatgaacggatttatgtgaaaatgcgcaatgatcgtgaggtc
cgaggtcgtttgcatgcgtttgatcaacatttaaacatgatattatctcaagtagaagag
acagtaaccaccgttgaattggacgaagaaaattttgaagaaatgcataaacagacgaaa
cgtcagataccgatgctgtttgttcgaggtgatgccattatacttgttgctccgcctctg
cgacatacataa

DBGET integrated database retrieval system