KEGG   Loa loa (eye worm): LOAG_17523
Entry
LOAG_17523        CDS       T02664                                 

Name
(RefSeq) chaperonin Hsp-60
  KO
K04077  chaperonin GroEL
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
loa04212  Longevity regulating pathway - worm
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_17523
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    LOAG_17523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_17523
   03110 Chaperones and folding catalysts [BR:loa03110]
    LOAG_17523
   03029 Mitochondrial biogenesis [BR:loa03029]
    LOAG_17523
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:loa04147]
    LOAG_17523
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     LOAG_17523
Chaperones and folding catalysts [BR:loa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   LOAG_17523
Mitochondrial biogenesis [BR:loa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    LOAG_17523
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LOAG_17523
  Exosomal proteins of other body fluids (saliva and urine)
   LOAG_17523
  Exosomal proteins of breast cancer cells
   LOAG_17523
  Exosomal proteins of colorectal cancer cells
   LOAG_17523
  Exosomal proteins of bladder cancer cells
   LOAG_17523
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 31251684
NCBI-ProteinID: XP_020306168
AA seq 572 aa
MFRISGQSMARLVSRTVRSGLRHYAKDVKFGADGRVSMLYGVDTLADAVAVTMGPKGRNV
IIEQSWGSPKITKDGVTVAKAIDFKDKYKNVGAKLVQDVANKTNEEAGDGTTCATVLARA
IAKEGFENISKGANPVEVRRGVMNAVELLVTELKKMSKDVTTPEEIAQVATISANGDSTV
GKLISEAMKKVGNKGVITVKDGKTLHDELETIEGMKFDRGYISPYFINTTKGAKVEFEKC
LLLFSEKKISQVQDIVPALELANKYRKPIVIIAEDVDGEALTTLVLNRLKVGLQVAAVKA
PGFGDNRKNTLKDMAVATGGTVFGDDANLLKIEDVQISDLGEAEEVSITKDDTLILRGKG
KPDDVEKRIAMIEDELEQSTSEYEKEKLNERLAKLSKGVAVLKVGGASEVEVNEKKDRVT
DALNATRAAVEEGIVPGGGVALLRAMKAIENIKGENTDQDKGIRIVQKAVREPIMTIVRN
AGVEPSSVVEKVLASNELPFGYDAMNDVFVDMFKAGIIDPTKVIRTALQDAAGVASLLAT
TECVVTEIPKEEPQMAAAGMGGGMGGGMGGMY
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgttccgtatcagtggacaatcgatggcacggcttgtttcacgtacagtgcgatcaggt
ctaagacattacgccaaggatgtgaaatttggtgcggacgggcgcgtttcaatgttgtat
ggagtggatacattagctgatgcagttgcggtcactatgggaccaaagggaaggaatgtc
ataattgagcagtcgtggggaagtccgaaaatcacaaaggatggtgttactgtggcgaaa
gcaatcgatttcaaagataaatataagaatgtgggagcgaaattggtgcaggatgtagca
aacaaaaccaatgaagaagctggcgatggtaccacatgtgctacagttctagcgcgagca
attgcaaaagaaggtttcgagaatatcagcaaaggagctaacccggtggaagttcgaaga
ggagtaatgaatgctgtggaacttttggttactgaattgaagaaaatgagcaaagatgtg
acaaccccggaagaaattgcgcaagtagcaacaatctcagcaaatggtgattccactgta
gggaaactaatatcggaagcgatgaaaaaggtcgggaataagggtgtgatcacggtgaaa
gatggcaaaacactgcatgatgaattggaaacaatcgaagggatgaaatttgatcgtgga
tacatttctccttacttcatcaacactacaaagggagccaaagtggaattcgagaaatgc
cttcttttgttttcagaaaagaaaatcagtcaagtgcaggatatcgtaccagctcttgaa
ctggcgaacaaatacaggaaaccaattgtgattatcgcggaggatgtagatggcgaagca
cttactacccttgtgcttaataggttaaaggttggtctccaagtggcggctgtgaaagca
cccggttttggagataacaggaaaaatacactgaaagatatggcggtggccacaggtggg
acagtatttggagacgacgctaatttgctgaaaattgaagatgtacaaatcagtgatctt
ggtgaagctgaagaagtttctatcacaaaagacgatacgctcatcttgcgtggcaaggga
aaaccggacgatgtggaaaaacgaattgcaatgattgaagatgagctggagcaaagcaca
tctgaatatgaaaaagaaaaactgaatgagcgactggcaaaactatcgaagggtgttgca
gtccttaaggtaggtggcgctagtgaagtagaggtaaacgaaaagaaggatcgcgttaca
gatgctttgaatgccacaagagcagccgttgaagaaggtattgtaccaggtggcggtgtt
gcactccttcgtgccatgaaagctatcgaaaatattaaaggagaaaatactgatcaggac
aaaggtatccgaatagtgcagaaagcagtacgggaaccgatcatgacaattgtgaggaat
gccggtgttgaaccatcttctgttgtggaaaaagtactcgctagcaatgaattgccattc
ggatatgatgccatgaatgatgtttttgtggatatgttcaaagccggtattattgaccct
acaaaggtcattcgaactgctctgcaggacgcggctggtgttgcatcactgttggccaca
acggaatgcgtagtgacggagataccgaaagaggagcctcagatggcagctgctggaatg
ggtggcggcatgggtggtggcatgggaggaatgtactga

DBGET integrated database retrieval system