KEGG   Loa loa (eye worm): LOAG_17788
Entry
LOAG_17788        CDS       T02664                                 

Name
(RefSeq) CCR4-Not complex component
  KO
K12604  CCR4-NOT transcription complex subunit 1
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_17788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_17788
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_17788
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_17788
SSDB
Motif
Pfam: Not1 CNOT1_CAF1_bind CNOT1_TTP_bind DUF3819 CNOT1_HEAT DUF1778
Other DBs
NCBI-GeneID: 9942315
NCBI-ProteinID: XP_020305860
AA seq 2636 aa
MSISVTPTSIALASIDRLLVIAAEKFDSNNPDSLFDKDFLNHLFVAPFSTESGIVDQYVF
RVLLDNIITSNTLLSDCLPASNPTNTAARSVSVSTVAFQKQQSLAIQQQPRSSSARKYNL
QLKDNFCAYVIRQQLKNCIKDPTATSIRLFYRFVEVLEERLVEIRYSLLGRFLETLLVSL
LSVDPSIQVLVGLILFSSSLVPQTTKGLGQYLRVVFRTLFEATRKDNSAVSDCALSTEFI
HQLFTSLFSTQIIEFVAIDQQSVICFLKIFEKELAIRGITLIRTLPPLQLILTAAPEGNS
KVSLSSAGSDHLSPFDYVDLEDKDLDEIMDSLAYQNPNLLAQQIQEIGTTFTLSVKSCRQ
HLISLNSGDGTILNAVNLSRVIVMMINTCSGSNMQQSVQPSILWDHRSGSVPATGTSSSA
ESLSTTTSGLSENSASVNSSQSMQQITWNAKNFANAIRELAPNLNWSEIIMHLDQTNFIV
RTKAQLQLLTAILLEGLGSNPFPIGLLYREWNFHKYGQLSWIEQILQNPDVFCFSDYPHK
AVNLTPLKVQPEETRELSNWRCLDLVDTLIRLGEVRKLVNGVMNILHKPTSTCPDVLLLA
LLQMQACYFLPSSNLRIHLMQMLIPTLIGNHPNAVPVLNVVWNCEDKVQLRPTILTALCN
YYMKSPDDQAKLSRILEVAHELKPDGLAELFNVPQFPFTIDLACLASRRDFLKLDKWVDD
KLAVYGDAFASQIICYIRRRLPAGMVNSSVLPQETIRALLNALSRTTCMSSASVNDLSSL
CCQIPGLKNSEGRLSAISTSRTQLSAAGAAHSSTSNVFSSGIGTPSVPVQQLTGSFGNFP
FGTTGFGASNRDMLAAAQQMQNRQHQQGNLPGSVQIFGSGTGTNLCVPGSTTGPFPQAND
LLKATNAANVLQPNFNGSHALSMSPSGQMMRTGFMSTGIPTTQTRSGPGAGGPGWSMPVG
IPGTGGVRTTPGSTSGPSSALDFRVPPGAPGSAGNILNGNSSFVHNAAGQQQQQQQASGG
SPGRITVPPAPMDDLTSVQFSEEIQNEANMYFQQIYSQHMQMPVADFVERLKQFKASNVQ
RDKDILACVVKNLFEEYRFFHEYPERELRTTAEVYGSIIREGVISNLQFATAVRKVIESL
QAEPGSMLWTFGIVALNACRTKLSLYPKVCVMIANQRNFQHFPQNLKDYVTSGIQGQQPH
VPGRETPNWQPQQRTITDMNRALAARSGSSVLSVTSVDTLVNATEKEGSQIKQPSETVME
KVAFLFNNLSQINLPKKVEEIKIMIEELDDNFIRWLAQYLVMKRVSIEQNFQPLYNLFLL
AIENRKLEEFVKLETFRNIKILLRSDKRQAATNFGDRQLLKNLGLWLGAITIARDHPIVT
SDLDMKSLLMEAYYKGQQELLFVVPFIAKILVSCSKSQIFGPNCAWIKAIFKILAELHNQ
PDLKLNLKFEIEVLCKELGVDLSKLTIEDVLKDTERLIRLPQQLGDLKMLKPPELQMAAS
PVPAVRVNSEASAEVVAGIPQTATADVDHLIGNLSSITMPRSQSPSGTQVQTPAHFHYHD
INIVSFDGLTPHLKLSASLPLFQLNPQLKHVVRPAISHAIKELIGPVTERAIRIAMHVTE
HICKKDFALEPDEQKMRRASQHMIRAMTAGMASITCREPLSSTILGFLKTAFTNSLRCNI
TPEQQKLIDEAATTIAEDNVELATNFIVKTACEKATPEMDKRLESEFTTRKQYRVEGRQY
ADPVALARAQQMPEKIRLRVGSVTNHQMVVYDEFSSRICGFKPTTAEDMIVDFSIMKSST
PTTMQPVIQQPGMDKEVEQFVTALQMLVHDIDSILSAYGVPNYRASAAIANIRDAVSQLA
SNPREPIQMHNCIQRIVEQVLCAYRNAEFQQHQLPPPEVDWNRRLKDIFLQLCRILLTQI
PLGDLARRMTRVIVDCRLDYRFNVDAMDLLAKHMLIQMNVYDQNLALLIDSGSNFEALIF
AQRFLKLLTMSNPTHSRQAVSESMPLTMEQLAKAQQFGQNRPTPESFATAAVPLGNEVGL
IGSRGVTSLPPPSTITDRVHNSLPAALAASAPPSGPIGSGTHLRSDNNVDDGAELQSKVE
MILREWIQLCYTPQAQKEPQQALAQIVHVMHEQGVISTDEMITRFFRLCTEMCVDVSYRL
IKNDVSGHPTTVVRQRCYYTLDAFVKLTCLMIKHSDGSQYQTKINLLKKVLNIITNVLHL
DHEVRGTDFHAMPYQRILIIMFNELTAPDPALDVISWHILEAFGQALFILQPRRVPGFAY
AWLDIIGHRNFIGRLLKESAEPMKTAAMYTQLIICHLKFLAPFLRNIQLPKSIAMMYKGT
LRVLLVILHDFPELLCEYHIVICDTIPPNCVQLRNLVLSAYPKNMRLPDPFGSNLKVDSL
LEMTQEPKMNINMAAIIPPDLRTQLDDYLNTRSSVDFHANLPSLLQVSNIAGSKYNTTVM
NAVVIYVGMRAIQAIHEKQQCITMTTIAHTAYMDIFQNLAVSLCTEGRYLLFNAIANQLR
YPNSHTHYFSCTLLYLFLEANTEVIQEQITRILFERLVALRPHPWGLLITFIELIKNPSY
SFWKHEFVRCAPEIERLFQSVANSCMGSNARHINANAPHASQLPAGSSPQAIQNVQ
NT seq 7911 nt   +upstreamnt  +downstreamnt
atgtctataagtgtgacgccaacttcgatagctctcgcctcaattgatcgtttattggtt
attgcggcagaaaaatttgattctaataacccggattctttgtttgataaggatttctta
aatcacttatttgtggcacctttttctactgagagtggcattgttgatcaatacgttttt
cgcgtattgcttgataatatcataacatcgaacacattactttctgattgtctacctgct
tcaaatccaacaaacacagctgctcgatctgtatctgttagtactgttgcatttcaaaag
cagcagtcacttgccattcaacaacaaccacggtcctcatcagctcgaaagtacaaccta
caactaaaagacaatttctgcgcgtacgtaattcgacagcagctgaagaactgtatcaaa
gatccaacagcaacttctatacggcttttttatcgctttgttgaagtattggaggaaaga
ttagtggaaatacggtatagtctacttggacgttttcttgaaactcttcttgtttcacta
ctatccgttgatccttctattcaagtgcttgttggccttattctcttctcttcttcactt
gtgccgcaaactaccaaaggacttggccagtatcttcgtgtcgtctttagaacattattt
gaagctaccagaaaagataattcagcggtctctgattgtgcattatctactgaattcatt
catcagctttttacgtcccttttctcaacgcagattattgaatttgttgcgattgatcaa
caatctgttatctgttttctgaaaatttttgaaaaagagcttgctatacgtgggattact
ttaataaggactctcccgccactccaacttattttgacagctgcgcctgaaggaaattcc
aaagtatcattatcatcagcaggaagtgatcatctttcaccctttgattacgttgatttg
gaagataaggatctcgatgagataatggatagcttggcttatcagaatccgaatttactg
gcacagcagatccaggaaattggtacgacatttacgttaagtgtgaagtcatgtcggcag
cacctgatctcgctgaattccggagatggaactattttgaatgctgttaatctttctcga
gttattgtgatgatgataaatacatgttccggctctaatatgcagcagtcggtccaacca
agtattttatgggaccatcgttccggaagtgttccagcaactgggactagttcatcggca
gaaagtttgtcgactacgaccagcggtctctccgaaaattctgcgagcgtaaactcatca
cagtcgatgcaacagattacttggaatgccaaaaattttgccaacgccattcgagagctg
gcaccaaacctaaattggtcggaaataataatgcaccttgatcaaacaaattttattgtg
cgaacaaaagcgcagttgcagttattaactgcaattttgttagaaggtcttggttctaat
cctttcccgataggcttgttgtatcgtgaatggaatttccacaaatacggccagttatca
tggattgagcaaatattgcaaaatcccgatgtattttgcttttctgactatcctcacaaa
gcagtgaatttgactccgttgaaagtacagccggaagaaacaagggagttaagtaactgg
cgctgtttggatttggtggatacgttgatacgactaggtgaagtgagaaaattggtgaat
ggtgtgatgaatattttgcataaaccaactagtacttgcccggatgttttgttgctagct
ttattacaaatgcaggcatgttattttttgccttcgtcaaatttgcgcattcacctaatg
cagatgctcataccaacgttgatcggaaatcatccgaatgctgttccggtactaaatgta
gtttggaactgcgaagacaaagtgcaattacgaccaacgattttaactgctctttgcaat
tattatatgaaaagtccagatgaccaagcaaaattgtcccgaatcttggaagtagcccat
gagcttaaaccagatggcttagccgaactattcaatgtaccacaatttccctttacaatt
gatttagcttgtttggcttcgagaagagatttcctgaagttggacaagtgggttgatgat
aaattagcagtatatggggatgcgtttgcttcacagattatatgttatatacgtcgccgg
ttaccagcgggcatggtgaacagtagtgtgttaccgcaagagacaataagagcgctattg
aatgctctttcacggacgacttgtatgtctagtgcatcagtcaatgatttatcctcgctt
tgctgtcagatacccgggctgaaaaacagtgaagggcgtttgtcagccatatcaacctct
cgaacgcaattaagcgcagctggagctgcacactcatcaacgtcgaatgtgtttagtagt
ggtataggaacaccatcggtgccggtgcaacagctcaccggcagttttggtaattttccg
ttcgggacaactggatttggtgcatcgaatagagatatgcttgcagctgcacaacagatg
caaaatcgacagcatcaacaagggaatttacctggatcagtgcaaatttttggaagcggt
acaggaacaaatctttgcgttccaggctcgactacaggaccatttccgcaagcaaatgat
ttacttaaagcgacgaatgcagctaatgttttgcagccgaattttaatggaagtcatgct
ctgtcaatgtcaccgtccgggcagatgatgaggacaggttttatgagtactggaatacca
acaacacaaacgcggtcaggacctggagctggaggacctggttggagtatgccagttggt
ataccaggaactggtggtgtacgaacaacaccgggatccactagtggtccttcttctgct
cttgattttcgcgtgccacctggtgctcctggttcagcaggaaatatattgaatggaaac
agttcatttgtgcataacgcagctggacagcagcagcaacaacagcaagccagtggcggc
tcgccaggtcgtattactgtacctccggcacctatggacgatcttacttccgtacagttc
agtgaggaaattcaaaatgaagcaaatatgtactttcagcaaatatactctcagcatatg
cagatgccggtcgcagattttgttgaacgcttgaaacagtttaaagcatcaaatgtgcaa
agggacaaggatattttggcatgtgtggtcaagaatttattcgaagaatatcgatttttt
catgagtatcctgaacgagagttaagaacaactgcagaagtatatggtagcattattcgt
gagggtgtgatatcgaacttgcagtttgctaccgcagtgaggaaggtaatagaatcattg
caagcagaaccgggtagtatgctttggacatttggaatcgtagcgcttaatgcatgtcgg
acaaagctgagtttatatcccaaagtatgtgtcatgattgctaaccaacgaaatttccag
catttccctcagaatttgaaggattacgtaaccagtggtatacagggacaacagccacat
gttcctggtcgtgaaacaccaaattggcagccgcaacaacgaacaataactgatatgaat
cgagctttagcagcacgttccggttcatcagtgttgtctgttactagtgttgacacactg
gttaatgcaactgaaaaagaaggtagtcagataaagcaaccatcagaaactgtaatggaa
aaagttgcatttttgttcaataatttaagccaaatcaatcttccgaaaaaggtcgaagaa
ataaaaattatgatcgaagaactggatgataactttattcgatggttagcacaatatctg
gtgatgaaacgtgttagtattgaacagaattttcaacctctctacaatctctttcttttg
gcaatcgaaaacagaaagttggaagaattcgtgaagttggaaacttttaggaacataaag
attctcttgagaagcgataaacgacaagcagcgacgaattttggcgataggcagttgcta
aaaaatctcggcttatggctgggtgcgattacaatcgcccgcgaccatcctatcgttaca
tcggatttggatatgaagtcccttcttatggaggcttattacaaaggacagcaagaactt
ctgtttgttgtacccttcatcgcgaaaattcttgtctcttgtagtaaaagtcagatcttt
ggaccaaattgtgcgtggataaaagcgattttcaaaattttggcagagcttcataatcaa
ccagacttaaaattaaatttgaagttcgaaatagaagtactctgtaaggaattaggcgtt
gacctaagcaagctcacaatagaagatgtgctgaaagatactgaacgcttgataaggctt
ccgcaacaattaggcgatctaaagatgttaaaaccacccgagctacagatggcggcttca
cctgtcccagcagtgcgtgtcaattctgaagcttctgcagaagttgtggcaggtatacca
caaacagcaactgctgatgttgatcatttgattggcaatttatcaagcatcactatgccg
agaagtcagtctccaagtggtacacaagtgcagacaccagctcattttcactatcatgat
ataaacattgtttccttcgatggtcttacaccgcatttgaagctgtcagcttcattacct
ttgtttcaattgaatcctcagttgaaacacgtcgttcggccagcaattagtcatgcgatt
aaagaattgattggaccagttactgagcgagcaattcggattgctatgcatgttacagaa
catatctgcaagaaggattttgcactagaaccggacgagcaaaaaatgcgtcgtgcctca
caacatatgattcgagcgatgacagcgggaatggcatccataacatgcagggagccacta
tcttcaactatcctaggatttcttaaaacggcattcacaaattctttgcgatgcaatatt
acacctgaacagcaaaaactaatcgacgaagctgcaacaactattgcggaagacaacgtg
gaattggcaacaaattttatagtcaagacagcatgtgaaaaagcaactcccgaaatggat
aaacgccttgaatctgaattcactaccagaaagcaatatcgtgttgaaggtcgacagtac
gctgatcctgttgcccttgcacgcgctcagcagatgccagagaaaatacgacttcgtgtt
ggatcggttacaaatcatcagatggttgtttatgatgaattttccagccggatttgtggt
ttcaagccaacaacagccgaagatatgatagtcgatttcagtatcatgaaatcgtctact
ccaactaccatgcagccagtgattcaacagcctggaatggacaaagaagtggagcaattt
gtgacagctttacaaatgcttgtgcacgatattgattcgatattatccgcttacggtgta
ccaaattatcgagcaagtgctgcaattgctaatattcgtgacgcagtatcacagttggca
tcaaatccacgtgaaccaattcaaatgcataactgtatacaacgcattgttgaacaagtc
ttgtgtgcatatagaaatgcagaatttcagcagcatcaactgccgcctccggaagtggac
tggaatcgcagattaaaggacatcttccttcaactttgtcgtatcctactaacacaaatt
cccttgggtgacttagctcgtcgtatgactcgagtgatcgtggattgccggttagattat
cgattcaacgttgatgctatggatctgcttgcgaaacacatgcttatccaaatgaatgtt
tatgatcagaatttggcgttgttgatcgatagcggcagcaattttgaagctttaatattt
gctcaacgatttttaaaactgttgacaatgagtaatccaacacattcgcgacaagcagtt
tccgaatcaatgcctctcacgatggaacaattggctaaggcacagcaattcggacaaaac
aggccaactcctgaaagctttgcaacggcagcagtaccactaggtaacgaagtgggactt
attggttcacgaggtgttacatcacttccaccaccttcaaccatcactgatcgtgtgcat
aacagtttaccagcagcacttgctgcatctgcgccaccgtctggtccaattggaagcggt
acgcatctaaggagcgataataatgtggacgatggtgccgagttgcagagcaaggtagaa
atgatattacgagaatggatacagctttgttacacaccgcaagcacagaaagagcctcaa
caagctcttgcgcaaattgttcatgtgatgcatgagcaaggtgttatatcaacagatgag
atgatcacacgtttctttcgtttgtgtactgaaatgtgcgttgacgtgtcatatagacta
ataaagaacgatgtaagcggccatccgacgaccgttgtacgacagcgatgctattataca
cttgatgctttcgtcaaactcacatgtttgatgatcaaacacagcgatggtagtcaatat
caaacgaaaatcaatttgttgaagaaagtattgaatatcatcaccaacgtattgcatttg
gatcacgaggtccgcggtactgattttcacgcaatgccatatcagcgtatcctaatcatc
atgttcaatgaacttaccgctcccgaccctgctttggatgtcatttcatggcatatatta
gaggctttcggacaggctttatttatcctacagccacgacgagttccgggttttgcttat
gcttggctagatatcattggacatagaaattttattgggcggctattgaaagaaagcgcc
gaaccaatgaaaacagctgccatgtacactcagttgattatatgccatttgaagtttttg
gctccattcttgcgtaatattcaacttccaaaatcaattgccatgatgtataagggtact
cttcgcgttttattggtgattctgcatgatttcccagaattgctttgcgagtatcacatt
gttatctgtgatactataccaccgaactgtgttcagttacgcaaccttgtacttagtgct
tacccaaaaaacatgcggctacctgatccgtttggctcaaatttgaaggttgatagcttg
ctagaaatgactcaagaaccaaaaatgaatatcaatatggctgcaatcattcctcctgat
ctaagaacgcaactggatgattatttaaatactcgctcatctgttgattttcatgctaat
ttgccaagtttgttgcaggttagtaacattgctggttcgaagtacaatacaaccgtcatg
aatgcagttgttatatatgttggaatgcgtgcaattcaagcaatccatgagaaacaacaa
tgcattacaatgactacaatcgcacacacagcatatatggatatttttcagaatctagca
gtgagcttgtgtactgaaggacggtatttactgttcaacgctatagcaaatcagctgcgt
tatccgaacagccacacgcattatttcagctgcaccctattatatctatttttagaagca
aatactgaagtaatacaggaacaaattacgcgaattctattcgagcgcctggttgcttta
cgcccacatccgtggggtttgctgatcacattcattgagttgatcaaaaatccaagctac
agtttttggaagcatgaatttgtgcgatgtgctccagagattgaaaggcttttccaaagt
gtggcaaattcttgcatgggctcaaatgcacgccacataaatgcaaatgcaccacatgca
tcgcaattaccagcaggcagcagcccgcaagctatacagaatgttcagtga

DBGET integrated database retrieval system