KEGG   Loa loa (eye worm): LOAG_17791
Entry
LOAG_17791        CDS       T02664                                 

Name
(RefSeq) partitioning defective protein 3
  KO
K04237  partitioning defective protein 3
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
loa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_17791
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LOAG_17791
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:loa01009]
    LOAG_17791
Protein phosphatases and associated proteins [BR:loa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LOAG_17791
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 9942781
NCBI-ProteinID: XP_020305863
AA seq 1107 aa
MYHTVSTTTDTAAIGPTGIVHCQQNANYVTILAIYDEPGFAVVDSTPASASQFAINGATS
SSSSSATPKTAASTESSLDSKLNIISSSNDGDIVEITNIAVPPTDGLRVTSDNAHTLQQK
PSSSSVITGSGYVSPLSLPLTHFDQKRSDICRIYHSALKNVSGSPRSKYRVTISPDADCQ
PSQESPIFTKQSLMTRTSARKSRLTDNFFDAKERLEEKLTSNIKSRTVKGDVKNMKLIPL
MEAANREQTVIILSDITINMNLGIEISPVHDPSNNMRLQAVEIRQIDDEGRVGNDGRLRI
GDRIVEINQRPVYQMSISRARAYLHEMQAVAHPSLTVDRSIETFTSDTISHRSQSSTSSL
QKRPIFSALQQANTTALGITFPVEIVKRSGGFGFTITSRETAKGERLFYIGTVKTDSAAV
NKLRAGDRLLQINGEKTTELTQNDMVERLKKLDVGDSINLLVSRLGSQENENHSPTILKS
NHDDNECCHPNEGTERYGEEILTMKIALNETGSAGLGISLKARAVMKPDGSRHDCGIFIK
KVLHGGAAYKDGRLKLDDQLIGIEDIDLRRMTRNSEASNAITKCLKNLGPNASIVCLRVA
RKVELRRNNDFLGMRSRKSSEVHDKSRTKSGDDDIATVKNQETSNSYNADVSRGRFSSSD
EHSLNANEDLDSTSSDRQKSVSEDEISHVDGSAFSRKNPARRSISEKRHLTVGNDANNTV
LFQKIKHNRQMSASPNRRSLSLESTEAHRSLTLTIASAHLREPTVRDARGEQTARRGHPS
TLKRAQKSRCNGYAKPSISDAEDQTSSGKHRDEPYASLPREISAASKEKRQRRKSVGSSI
FSKITQRLGGSRSRDASPEKMVSFDSAESNSFVDKASRTQDHGEWNKESKSNKLISRAPP
TYKPSSYDVFQLADPDCLVSEQGASGNMPFDRREQYQTAVCNNGYSGRKERNSYINRQTR
NGYGNELYVQSHQQPQQQRRQQYTVHSQCYYGEQREQQQQRTTYYTGCSTNYYDAFNAWF
AYSAAATHGNMPIITRRSGYPSQHIYLPTAAETVSSNRAAVRQIHHERFRSCPTQFSSSR
MRTRQSIERTGPYYASGYASHSGISDF
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgtatcatacggtgtccacaacaacagatactgctgctatcggtcccactggcatcgta
cactgccaacagaatgcaaattatgttacaatattagcgatctacgacgaaccaggattt
gctgtagtggattcgactccagcaagtgcctctcaatttgccatcaacggagcgacatca
tcaagttcttcatcggcaactccaaagaccgctgcatcaacagaaagttcactagatagt
aaattaaacatcatttcaagttccaacgatggtgatattgttgaaataacgaatattgct
gtaccgccaactgatggtttacgagtgacttcggacaatgcccacacactgcaacaaaag
ccatcgtcatcctcagttataacgggttctggatacgtttctccattgtctcttccattg
acacattttgatcagaaacgtagtgatatatgtcgtatctatcattctgcactgaaaaat
gttagcgggtcaccgagaagtaaatatcgggttactatatctccagatgctgattgtcaa
ccatctcaagaatcgccaattttcacaaaacagtcattgatgactcgaacatctgctagg
aaatcgcgtcttactgataattttttcgatgccaaagaacgactggaagaaaaattaaca
agtaatatcaaaagtcgtacagtaaaaggagacgtgaaaaatatgaaattaataccactg
atggaggcagcaaatcgagaacaaacagtgattatactttcagatatcactattaatatg
aatttgggtattgagatttcacccgtacatgatccatcaaacaatatgcgcttacaagct
gtagaaatccggcaaattgacgatgagggtcgagttggcaatgatggacgtcttcggatt
ggcgaccgtattgtagaaatcaaccaacgtcctgtttatcagatgtcgatctcaagagca
cgtgcctacttacatgaaatgcaggcagttgctcatccaagtttaacagtcgatcgctca
atagaaacatttacaagcgatacaatttctcatcgtagtcagtcatcaacgagcagtttg
caaaagcggccaatattctctgcgctgcagcaggccaacacaacagctcttgggataaca
tttccagtggaaattgttaaaagaagtggcggattcggttttaccataacgagtcgtgaa
actgctaaaggtgaacgactattctatattggtactgtgaaaacagatagtgctgcggtt
aataaattaagagctggtgataggttactacagatcaatggtgagaaaacaactgaactt
acccaaaatgatatggtcgaacgtctcaagaaactagatgttggtgattcaataaactta
ttagtttcgcgattaggaagccaggaaaacgaaaaccacagtccaacaatattgaaaagt
aatcatgacgataatgaatgctgtcacccgaatgaagggacggagcgatatggagaggag
attttgacgatgaagattgctttgaatgaaactggtagtgctggattgggtataagcttg
aaagcaagagccgttatgaagcctgatggttcgcgtcatgattgtggaatatttatcaaa
aaggtcttgcatggtggtgctgcatataaagatggaagattaaaactagatgatcagttg
attggaatcgaagatattgatttaaggcgaatgacgaggaattcagaagctagcaatgct
atcactaaatgtttgaaaaacttaggacctaacgcaagtattgtatgcttacgtgttgca
aggaaggttgaattacgccggaacaatgattttctaggtatgagaagtcgtaagagttct
gaagttcatgataaatctcggacaaagtccggagatgatgatattgcgactgtaaagaat
caagaaacatcaaatagttataatgcagacgtatcaagaggccgatttagcagttcggac
gagcattccttaaatgcaaatgaagatttggattccacctcaagcgatagacaaaagtct
gtatcagaagatgaaataagccatgttgatggcagtgcatttagtcggaaaaatcctgcc
aggagatcgatatcggaaaaacggcatctgactgttggaaacgatgcaaacaacacggtg
ctttttcaaaaaattaagcataatcgtcaaatgagtgcatctcctaatcgtcgttcatta
agcctcgaaagtacggaggcgcaccgatctctaacattgacaattgcctcagctcatctt
agggaaccaaccgttcgtgacgctcggggggagcaaacggcaagacgaggccatccgagc
actctcaagcgagcccagaaatctcgatgtaatggttatgctaagccgtccatttccgat
gcggaagaccaaacatcttcagggaaacatcgggacgaaccgtatgcgtcattacctcga
gaaatttctgctgcttctaaggaaaaacgacaacgaagaaaatcagttggaagtagcata
ttttcaaagattactcagagacttggtggctcgagatcgcgtgatgcatctccagaaaag
atggtatcattcgactctgcagaaagcaactcttttgtcgataaggcgagcaggacgcaa
gatcatggagagtggaataaagaaagcaaaagtaataagttgataagcagagcaccacca
acctacaaaccatcgtcctatgacgtttttcagctagcagatcctgattgccttgtgagc
gaacaaggagcatccggaaatatgccatttgataggagagaacaatatcagacagcagtt
tgcaacaacggatacagtggtcggaaagaaaggaactcatacatcaatcgtcaaacaaga
aacggatatggtaatgaattatacgtacaatcccatcagcaaccgcagcaacaacggcga
caacaatacacagtccactcgcagtgttattacggagaacaacgcgagcaacagcaacag
cgcacaacttattacacgggatgtagtaccaactactacgatgccttcaatgcttggttt
gcatacagtgcagctgccacacacggaaatatgcctatcattacaagaagaagcggatat
ccatcccagcatatttacttacctacagcagcagaaacagtgtcgtcgaacagagcagcg
gtacgacaaattcaccacgaaagattccgatcgtgtccaactcaattttcctcatcaaga
atgcgaacgaggcagagtatcgaaaggactggtccctactacgcaagtggctatgcctcc
cattccggtatttccgacttctag

DBGET integrated database retrieval system