KEGG   Loa loa (eye worm): LOAG_17796
Entry
LOAG_17796        CDS       T02664                                 

Name
(RefSeq) cell differentiation protein RCD1
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_17796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_17796
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_17796
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 31251753
NCBI-ProteinID: XP_020305869
AA seq 288 aa
MDAGGSSTGSSQVEAIDKEQVFEWILDLSDSNKREQALLELSKKRETVPDLPLWLWYSFG
SMASLLQEVISIYPAIMPPTLTAGQSNRVCNALALMQCVASHKETRSPFLQAHIPLFLYP
FLHTTKTSRPFEYLRLTSLGVIGALVKTDEQEVIQFLLSTEIIPLCLRIMENGTELSKTV
ATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLHLAKEPSQRLLKHVVRCYSRLSD
NPRALQALRQCLPDQLRDETFTRVLADDKSTKHWLKQLLKNIGFSVSP
NT seq 867 nt   +upstreamnt  +downstreamnt
atggatgctggtgggagtagtactggatcttcccaggtggaagctattgataaggaacaa
gtgtttgagtggatcttggatttgagtgattcaaataaacgagaacaagcacttctggaa
ctgagcaaaaagcgagagacggttcccgacctacctttgtggctgtggtattcatttggc
tcaatggcttctctgttgcaagaagtaatctcaatttaccctgcaattatgccaccgaca
cttaccgcagggcaatcgaatcgtgtttgtaatgctctagctttgatgcaatgtgttgct
tcacacaaagaaactagaagtccatttttgcaggcccatattccgttgtttctgtatcca
ttcttgcacacaacgaaaacttcgcgacctttcgaatatcttcgtttgacatctttaggt
gtcatcggtgcattggtgaaaactgatgaacaggaagttatccagtttctgctttcaaca
gaaataattccgttatgtttgcggattatggaaaacggaacagaactgtcgaaaacagtg
gctactttcattctacagaaaatactgcttgatgataccggtttagcatacatctgccaa
acttatgagcgtttttcccacgttgctatgatcttgggtaaaatggtattgcatttggcc
aaagaaccgtcacagcgacttttgaagcatgttgttcggtgttacagtcgtctttccgac
aatccaagagcgttgcaggcattacggcaatgtttgccggatcagttgagggatgagaca
tttactcgagttcttgcagatgacaagtcaactaaacactggttgaaacaacttctaaag
aacatcggtttttctgtgagcccttga

DBGET integrated database retrieval system