KEGG   Loa loa (eye worm): LOAG_17979
Entry
LOAG_17979        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K03681  exosome complex component RRP40
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_17979
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_17979
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     LOAG_17979
SSDB
Motif
Pfam: KH_6 PCB_OB
Other DBs
NCBI-GeneID: 9944242
NCBI-ProteinID: XP_020305642
AA seq 245 aa
MAEIHLPGDILSLVVPGKGRTEIIGCGLERVINNPDQLLVVQPGIRRVSHGKQWMAVHSR
RYVPQKGDFVIGIVTSVHGETFKIDIGAADIAFISFLSFEGATRRNRPNLKVGDLIYASV
TTATKHLEPELTCVDGEGRARGMGPLPSGGFLFKTSLNLVRRILSPTSKLLSLIGKDIKF
EITSGINGRIWIKGINVVEVIAVYRIIKDSEFIPEPDIPAFVDKQISRLYGFPVVTDDSN
NDRIS
NT seq 738 nt   +upstreamnt  +downstreamnt
atggctgaaattcatcttcctggtgatatcctttctctggtagttcctggtaagggacgg
acagaaatcattggttgtggtctagaacgtgttatcaataatcccgatcaattgttagtc
gtacaaccgggaatacggcgtgtatcgcatggtaaacaatggatggcggttcattcacga
aggtatgttccacagaagggtgattttgtaattggaattgttacttctgtgcatggtgaa
acatttaaaattgatatcggcgctgctgacatcgcttttattagtttcctttcctttgaa
ggtgccacaagacgtaatcgtccaaacttaaaagttggtgatttaatttatgcatctgtt
actactgcaacaaaacatcttgaaccagagcttacatgtgttgatggcgagggtcgagca
cgtggtatgggtccattaccatccggtggatttttgtttaaaacaagcctaaatcttgta
cgtcgaattctttcaccaacttcaaagctgttatcactaattggtaaagatataaaattc
gaaataacaagtggcattaatggacgaatttggatcaaaggcataaatgtcgtggaagtt
atagctgtttatcggataattaaggattcagagtttataccagaaccagatattccagct
ttcgtagataagcaaattagtcgtttatatggctttccagtagttactgatgacagtaat
aatgaccgaatatcgtag

DBGET integrated database retrieval system