KEGG   Loa loa (eye worm): LOAG_18173
Entry
LOAG_18173        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K12599  antiviral helicase SKI2 [EC:3.6.4.-]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_18173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_18173
Enzymes [BR:loa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     LOAG_18173
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     LOAG_18173
  mRNA degradation factors
   3'-5' decay
    Ski complex
     LOAG_18173
SSDB
Motif
Pfam: DSHCT DEAD rRNA_proc-arch Helicase_C ResIII
Other DBs
NCBI-GeneID: 9943208
NCBI-ProteinID: XP_020305437
AA seq 1000 aa
MARKYPFELDPFQQQAVVCLDRGDSVFVAAHTSAGKTVVAEYAVALCSLHKTRAIYTSPI
KALSNQKFREFKLIFEDVGLITGDIQLHPEAFCLIMTTEVLRSMLYNGSEIIRELEWVIF
DEVHYINDAERNNSDNREYSLNVNSTALIIVGTTVNKFVHAILSGTRGHVWEEVLIMLPA
HAKIVMLSATVPNCVEFADWVGRIKKKQIYVIMTARRPVPLEHFLYTGQDGKTKKDMFKI
IDSDGQFVQKGYQLDIGIHFMNLYFAYFALIDKNVYITVIDHLRMQNICDDNAYLLRSVD
LTTEKEKSSIHHFFSKCIARLRGSDKRLPQVLQMKELCKHGFAIHHSGILPILKEVVELL
FQKGLVKVLFATETFAMGVNMPARTVIFDSLQKHDGRQLRMLNPGEYIQMAGRAGRRGLD
ATGTVIVLCKGPYVPDYLDLVNCMQSFQGKPTKLESRFRVTYSMLLNLLRVEYLSIEDVL
RRSYVESASLRLALAHKARLKEVEKLLVSKEDPNCTACFPIESRSIVDYYENLKIFLRSR
AELWPELIRFSVVDKLLAPGRLIIVCLPEVGRIATVAILLKITVDGNSKKMTLLLSVEGD
QQIREKCEIDSFTRMPQEERQEICETSLLQCAALYGLEGLPPQKFSDQVRRIGFVLDGIS
FDRLIAICQRTVKIDPLAIIEDIKSRNHPNHRTKSPNEGVRKIINEIDNITANWDSTKKG
NIKLPGQDIQVSDIDIFQKLLHLNDLRNFLINDANFHCRQCPLFREHFIYIHDKRSLQEK
CDELRVRLSAGGLLLSQDYYDRIKLLRRLNYIDDSNLVSLKGRVACEIHHQELLITELML
DNKFHYRSTAEIAAMLSVTTCQHRSREGDYRKDKEDEIVRPPPVLKELKDDIIEVCNRIG
TFQRECGVKDVDISEELSFDLMHAVYEWANSMPFADIMQLTDAQEGLIVRCIQRLDELCR
DIRNAARLVGDPALYEKMDDTSAAIKRDIVFAASLYTVMD
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggcaagaaagtatccgtttgaactggatccattccaacagcaggcagttgtctgttta
gatcgtggtgattccgtattcgttgccgctcatacttcggccggtaaaaccgttgttgct
gaatatgctgttgctttgtgcagtttgcataaaaccagggcaatatatacatcaccaata
aaagcactttcaaatcagaaatttcgcgaatttaagctgattttcgaagatgttggtctt
ataacaggtgatatacaactgcatccagaagctttttgtctcataatgacaacagaagtt
ttaagatctatgctttataatgggtcggaaattatccgcgaattagaatgggtcattttc
gatgaggtacattatatcaatgatgcggagagaaataacagtgacaatcgcgaatactcc
ttgaatgttaatagtactgcactgatcattgttggaacaacagtaaataagtttgttcat
gctattctttccgggacgcgtggacatgtttgggaggaagtgctaattatgctgccagct
catgcgaaaattgtcatgttaagtgctaccgtgcctaattgtgttgaatttgctgattgg
gttggacgcatcaaaaaaaaacagatttatgtgattatgactgcacgacgtcctgtgcca
ttggaacactttttgtatactgggcaagatggtaaaactaagaaggatatgtttaaaatt
atcgatagcgatggacagtttgtgcaaaaagggtatcaacttgacattggaattcatttc
atgaatttatattttgcatattttgctttaattgacaagaatgtttacatcactgttatc
gaccatctacgcatgcagaacatatgtgatgataatgcatatttgttgcgatcagttgat
ttgactacagaaaaggaaaagtctagtatacatcatttcttctcaaagtgtattgcgcgc
ttgaggggttcggacaaacgtcttccccaggtactacaaatgaaggaattgtgcaagcat
ggttttgcaatacatcacagtggtattttgccaattctaaaagaagttgtcgaattgctt
ttccaaaaaggactggtcaaggtattgtttgctactgaaacttttgctatgggtgtcaat
atgcccgctcggacggtaattttcgactcactgcagaaacatgatggccgtcagttgcga
atgttgaatcccggggaatatattcagatggctggtcgagctggacgacgaggtttggat
gctactgggaccgtaattgttttatgtaaagggccttatgttcccgattatttagattta
gtcaattgtatgcagtcattccagggcaaaccaacaaagttggaatcacgatttagggta
acatattcgatgcttctgaatttgttgcgggtagaatatctgagtatcgaggacgtacta
cggcgaagctacgttgagagcgcatcattgagattagcactagcacataaagcacgctta
aaagaggtagaaaaactgctagtatcaaaagaagatcctaattgcacagcatgttttcct
atcgaaagccgttcgattgttgattactatgagaacttaaagatattcctacgatctcga
gctgaattatggcctgaattaattcggttttcggttgtagataaattgctagcaccggga
cgtttaattatcgtttgtttgccagaagttggacgaattgctactgtggcaattcttctt
aagataacggtggatggaaattcaaaaaaaatgactttactactgtcagtggaaggcgat
caacaaatacgtgaaaaatgtgaaatagatagtttcacacgaatgccacaggaggaacga
caagaaatctgtgaaacaagcttattgcaatgtgcagcactttatggtcttgaaggtcta
ccaccgcaaaaattctcagatcaagtacgaagaataggctttgttttggatggtatatca
ttcgatcgtttgatagcaatttgtcagagaactgtgaagattgatccgctggctattata
gaagatataaaatcacgaaatcacccgaaccatcggactaaatcgccaaacgaaggtgtc
cgaaaaataattaacgaaattgataatataacagcaaattgggatagtaccaagaaggga
aatataaagttaccagggcaagacatacaagtgagcgatattgacatatttcaaaaattg
cttcatttgaatgaccttcgcaatttcctcataaatgatgcaaactttcattgtcgacaa
tgtccgctattccgagagcatttcatatatatacatgataaaagaagcctacaagagaaa
tgtgatgaactccgtgtaaggctttcagctggtggtttgcttctttcacaggattactat
gatcgtattaagcttttacgccgactgaactatattgatgactcaaatttggtttctctg
aaaggtcgcgtggcatgcgaaatacatcatcaggaattgctaattacggaattgatgctg
gacaacaaatttcactatcgttcaactgcggaaatagcagccatgctttcagtaaccact
tgtcagcataggtcaagagaaggcgattatagaaaagataaggaagatgaaatcgtgcgt
ccaccaccagttctaaaagagttgaaagatgacatcatagaagtttgtaacagaattggg
acattccaacgagaatgtggtgtaaaagatgtcgacatttctgaagaactaagctttgat
ttgatgcatgccgtttatgaatgggccaattccatgccatttgctgatataatgcagctg
acggatgcacaggaaggtttgattgtacgttgtatacagaggttggatgaattatgtcgc
gatatacgaaatgctgctcgactagttggtgaccctgcattgtatgagaaaatggacgat
acatcggcagctataaagagggatattgtttttgctgctagtctttatactgttatggat
taa

DBGET integrated database retrieval system