KEGG   Loa loa (eye worm): LOAG_18180
Entry
LOAG_18180        CDS       T02664                                 

Name
(RefSeq) leucine-rich repeat-containing G protein-coupled receptor
  KO
K04249  thyrotropin receptor
Organism
loa  Loa loa (eye worm)
Pathway
loa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:loa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    LOAG_18180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:loa04030]
    LOAG_18180
G protein-coupled receptors [BR:loa04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    LOAG_18180
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5
Other DBs
NCBI-GeneID: 9944203
NCBI-ProteinID: XP_020305427
AA seq 843 aa
MALIKHSVYIITAIQLNAVYEKVCRVERGCSCTVFISEPKCCCVGQSVTEIPGNLTDNVR
RLLLYNVGINHIRKNAFSRYQHLEEIVIEDSDALQSVDADAFGNLYNLGKLLVQMTPRHR
LAMEVIDFSYNHIEYLGDGQLRAVHANKIRLNNNDLREIGSHIFANCRFSLLELNDNLEL
KRLSIDTFAGISFIKLLDLSRTGITELPTTGLSRLEGLKLKDTEELKKLPPILAFTSLKK
VEFTYPYHCCLFKYASKEISTAGEMYTKNLEEIRNRECSAKSTPKLNRQRRQSARNDRSI
LLPQESRENPLDFSDLLQWFDSVNAGNITIEIDDDWDTLLEPEFEDADVGLLTTFNCTSS
AVSDFFASIQCTPMPNALNPCEDVIGYDFLRWVIWFVWVSAIVGNIGVWIVLCQMGQKRM
QVHYFFMANLSTADLLTGVYLGVLAIADYKTSNEYYNYAVAWQTGIGCNIAGFISVFSSE
ISIMSMFLIAFDMCYNIRNAFYGKRLRMRTAIMMMVVAYIIAFTMAVLPIIGVSTYTSTS
VCLPLSIEDNFDRIYVIASLLFNLLAFLGMAISYSFIVTMLCDPEQPKRSEDKAIILKMA
TLIGTEMLCWFPTLFFGLTAALGHPLISISVAKIFLVLFYPINAFTNPFLYVFFTKITHI
RLCPVSFLSNKTANIPNELKYHHYHSYLRTLRKTKESKLMVEKHVQRQSSLLDLRKAFKN
YDVYRSLPTSTFRKEMPTHSSTQSERRSLIFTGRLRVSTAPRMSDISEHVTLEKNITPNS
LSHTSSSFSQQQLSTEQNYVVSPKELQNRRPSVRSTGKDSGRGSLTPPIPSYRFQCFPNE
SPT
NT seq 2532 nt   +upstreamnt  +downstreamnt
atggcactgataaaacattctgtgtacattatcactgctatacagctcaatgcagtgtat
gagaaagtttgtcgtgtggagcgtggttgtagctgtaccgtatttataagtgaaccaaaa
tgttgctgtgttggacaatcggttaccgaaataccgggaaatttgactgataatgttcgc
cgtctattactctataatgtgggcatcaatcacattcgtaaaaacgctttcagtaggtac
caacaccttgaagaaattgtaattgaggattcggatgcattgcaatcagttgatgctgat
gcatttggcaatctatataatcttggcaaactgttagttcagatgacaccgagacatcga
ttagccatggaagtgatcgatttctcctacaatcatatcgaatatttgggagatggacaa
cttcgagctgttcatgctaataagattcgtctcaacaataatgacttacgtgaaattgga
agtcatatatttgctaactgtcgattttcattgctagaactgaacgataatttagaactt
aaacgtctttcaatcgatacctttgctggcatatcatttatcaaacttcttgatctttca
cgtaccggtattacggaacttccaacaactggtctgtctcgtttagaaggcctaaaattg
aaggatacagaagagctgaaaaaattgccaccaattttagcatttacatcattgaaaaaa
gttgaattcacttacccatatcattgctgcttgtttaagtatgcctctaaagaaatcagt
acagctggtgaaatgtacacgaaaaatctggaagagattcgaaatcgcgaatgttccgcc
aaatcaacgccaaaattgaaccgtcagcgacgacaatctgctcgaaatgatcgttcaata
ttgctgccacaggaatcgcgggaaaatccgctagatttttccgacttgttgcagtggttt
gattctgtcaatgctggtaatattactattgagatagacgacgactgggacacattattg
gagcctgaatttgaggacgccgatgttggacttctgacgacattcaactgtacgtcgagc
gctgtcagtgatttctttgcttccatccaatgcactccgatgccaaatgcgctgaatccc
tgcgaagatgttattggatatgactttttacgttgggtaatatggttcgtatgggtttcg
gccattgttggtaatataggggtatggattgtgctatgtcaaatgggacaaaagagaatg
caagtacattatttcttcatggctaatttgtccactgcagatttgttaacaggtgtctat
cttggtgtattggcaatagcagattataagacatcaaatgagtattataactacgcggtt
gcttggcagaccggtatcggttgtaatatagccggtttcatttccgttttcagttccgaa
atctccattatgtcgatgtttctgattgcttttgatatgtgctataatattagaaatgcc
ttttacggaaaacgtttacggatgagaactgcgataatgatgatggtcgtggcatatatt
atagcgtttacaatggcagtactaccaattataggtgtatccacatatacaagtaccagt
gtatgtctacctctttccattgaggataattttgaccggatctatgtaattgccagtttg
ttgttcaatttgcttgcatttttgggtatggctattagctatagtttcattgtaacaatg
ctttgtgatccggaacaaccgaaacgatcagaagataaagcgatcattttgaaaatggca
acactaattggtacagaaatgctttgctggtttccaactcttttctttggtctgacggca
gctttaggacatcctctaattagtatcagtgtggcgaagatatttttagtactattttat
ccgatcaatgcatttacgaatccgttcctgtacgtattctttaccaaaattacgcatata
cgactgtgtcccgtatcattcctgagcaacaaaacagcaaatatccccaatgaactgaag
taccatcattaccattcatatctgcgaacattgagaaaaacgaaagaatcaaaactaatg
gtcgagaaacatgttcaacgacagagttcattgttggatttgcgaaaggctttcaaaaat
tacgatgtctacaggtcactaccgacgtcaacattccggaaagaaatgccaactcattca
agtacacagtctgagagacgatcgctaatcttcactggacgactacgagtttcaacagca
ccacggatgagtgatatttcagaacatgttacattagaaaagaatatcaccccgaattct
ttatctcatacatcgtcaagtttttcacagcaacaactgtcaaccgaacagaattatgtg
gtatcgccgaaagagctacagaaccgtcgaccaagtgttcggagtaccggtaaagatagt
ggccgtggtagcttaacaccgccgattccatcatatcgttttcagtgtttcccgaatgaa
tctcccacttag

DBGET integrated database retrieval system