KEGG   Loa loa (eye worm): LOAG_18420
Entry
LOAG_18420        CDS       T02664                                 

Name
(RefSeq) hypothetical protein
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_18420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_18420
Enzymes [BR:loa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LOAG_18420
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LOAG_18420
 Prokaryotic type
     LOAG_18420
SSDB
Motif
Pfam: HHH HhH-GPD HHH_5 HHH_8
Other DBs
NCBI-GeneID: 9948054
NCBI-ProteinID: XP_020305170
AA seq 204 aa
MAASVKKRRKVIKVVFDKEEHCSKDGYELGIAEMEELPLWKKHLENIKQMRSNWDAPVDS
MGCHMLADALAEPKKKALYIKKVAKILKERYDGDIPNTIEELCSLPGVGEKMAYLAMCNA
WDQMKGLGVDTHVHRISNRLGWIKTSNPKESRIALEALVPREEWQELNKLLVGFGQQTCL
PVLPKCSECLNRNICAAIGVKKKR
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcagcatcggtaaagaaacgtcggaaagtgatcaaagtagtatttgataaagaagag
cactgttcaaaagacggatatgagctcgggattgctgaaatggaagaactacctttatgg
aagaaacatttggaaaatatcaagcaaatgcgaagtaattgggatgccccggtggatagt
atgggttgtcatatgcttgctgatgcacttgctgaaccaaagaaaaaagctttgtacatc
aagaaggtagcaaaaattttgaaagagcgttatgatggcgatataccgaatacgattgaa
gaactttgctcacttccgggtgttggcgaaaagatggcttatcttgcgatgtgtaatgca
tgggaccagatgaaagggcttggtgtcgatacacatgttcatcgcatcagtaacagactt
ggatggattaaaacctcaaatcccaaggaatctcggatagccctggaagcgttggttcca
cgtgaagagtggcaagaattgaataaattgctagtcggcttcgggcagcaaacatgttta
cctgttttaccgaaatgttcggaatgtttaaataggaatatatgtgctgctataggagtg
aagaaaaaacgttga

DBGET integrated database retrieval system