KEGG   Loa loa (eye worm): LOAG_18465
Entry
LOAG_18465        CDS       T02664                                 

Name
(RefSeq) mRNA-decapping enzyme 2
  KO
K12613  mRNA-decapping enzyme subunit 2 [EC:3.6.1.62]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_18465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_18465
Enzymes [BR:loa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.62  5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase
     LOAG_18465
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_18465
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     LOAG_18465
SSDB
Motif
Pfam: DCP2 NUDIX
Other DBs
NCBI-GeneID: 31251939
NCBI-ProteinID: XP_020305118
AA seq 578 aa
MIRKQHPARMTVHNRNLRSIDSTDVGGGGGCGDKCENPRRGRQKSGSKRSSVGARMSKGS
ITESSDLRTKNSTSFGPPIPDDILDDLCFRFLINIPDDQKNAPVRLCFQIELAHWFYIDF
YCKGNNANVKCPEVSLRDLVGQIFNHCDFLIQYTDSVDKVMAEWRIYKSGVPTYGAALLD
NSLNYVLLVQGYFAKNSWGFPKGKVNEDEEAMACASREVMEEVGFDISDKICKTRLIQCF
VNDTLIRLYIIRDVPIDFPFAPNTRNEIGKIQWFCIWDLPKDRNDFIACERIGMSPSNFY
TVIPFVKELQSYVSKHHNTHNKPRHKPMDAINISTRSSSAFSPVQPQQKNEMLAPALSPL
FNMKTPTHMNRSMVSRHSSQHASPNSAFFKPLTSSAQHISYTGTAFVQMLSRASCTSIEV
TNYAKSPERVKMKEVTRPVPTVPKAAMPILGRPVYDAFRDEAEKKVVTSLQESSDKTFLS
DILCHGITETNEVINYPTDNSEKKSVGYDSCCNLPVKNNISPLPLNPGEDLMKNYLKGVG
GCLKNSRVLMTSRVTEDRPLINLCKAWKDFKFDVSRLF
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgattcgtaaacagcatcctgcacgaatgacagttcataatcgaaatttacgaagtatt
gattccactgatgttggtggtggtggtggatgtggtgacaaatgcgagaatccgcgacgt
ggtcggcaaaaaagtggctcaaaaaggagtagtgttggagcaagaatgtctaaaggatca
attactgagtcttcagatttacgaacgaagaattctacatcatttggcccacccatacct
gacgatattttagatgatctttgcttccgattccttatcaatattccagacgatcagaaa
aatgctcctgtacggctctgctttcaaatcgagttggcacattggttttatatagatttt
tactgcaaagggaataatgcaaatgtaaagtgtcctgaagtgagcttgagagatttggtc
gggcaaatattcaaccattgtgatttccttatccaatacacggatagcgtcgataaggtg
atggcagaatggcgtatttataagtctggcgtgccaacatatggtgctgcgctcttggat
aactctttgaattacgtgctattggttcaaggatattttgcaaagaacagttggggattt
ccgaaggggaaagtaaacgaagatgaggaagcaatggcttgtgctagtcgagaggtaatg
gaggaagtgggtttcgatatttccgacaaaatttgcaaaacacgtctaattcagtgtttt
gtgaacgataccttaatacgattgtatataatacgcgatgttcccattgatttcccattt
gctcctaatactcgaaacgagataggtaagattcaatggttttgtatttgggatttgccg
aaggatcggaacgatttcattgcatgtgagcgaattggtatgtctccaagtaatttctac
actgtgattccattcgtcaaagagctgcagtcatatgtttcgaagcatcataatacgcac
aacaaacctaggcataagccaatggatgcgataaatattagcacacgctcatcaagcgca
ttcagtccggtgcagcctcaacagaagaatgagatgctagcaccagcactgagtccttta
ttcaacatgaaaactccaacacacatgaatcgttcaatggtttctcggcattcttcccag
catgcatcaccaaactcagcatttttcaagccgttgacatcatctgcgcagcatatttca
tatactggtactgcctttgtgcagatgttatcccgcgcttcctgcacgagcatcgaagta
acaaattatgcgaaatctccagaaagagtgaagatgaaagaagtaacgagaccagtaccg
acagttccaaaagcagctatgccaatacttggtcgcccagtatatgatgcattcagagat
gaggcggaaaagaaggtggttacatctttacaagaatcatcagataaaacattcttgagt
gatattctttgtcatggaatcacggagacaaacgaagtaatcaattacccaactgataac
agcgaaaagaaaagtgtgggatatgacagttgctgcaacctgccggtaaagaacaatatc
tcaccactgcctcttaatccaggggaagatttaatgaaaaattatttaaaaggagttggt
gggtgcttgaaaaactcgagagttttaatgacgagtcgtgtgactgaagataggccactc
attaatttgtgcaaggcctggaaagacttcaagttcgatgtctcgcggttattttga

DBGET integrated database retrieval system