KEGG   Loa loa (eye worm): LOAG_18491
Entry
LOAG_18491        CDS       T02664                                 

Name
(RefSeq) DNA ligase
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
loa  Loa loa (eye worm)
Pathway
loa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOAG_18491
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:loa03400]
    LOAG_18491
Enzymes [BR:loa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LOAG_18491
DNA repair and recombination proteins [BR:loa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     LOAG_18491
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C zf-PARP zf-CCHH RNA_ligase NHR2
Other DBs
NCBI-GeneID: 9949882
NCBI-ProteinID: XP_020305093
AA seq 840 aa
MSSKFGLDYAKRVAKCKKCQQQLLKGDLRMWRMVPNPFTADSGNPTEMKNYFHIDCLFET
LTRSRATTKVIDSPDDIEGWDVANDDDKASIIEKIRDLSELRLKKFGDKVKTSASKDTLK
KAVAKDISSKKVKDEKVETVISARKKEKYKTAKKDSKEITSRKVGDSKTSVSTVKNEQST
AEILETSKTEDSIQKIGSKFDMFKLFCKLCDVIASVSKYTEKTEAVKIFINKEGYDGDLH
LLLKFLIPEADQRIYNLKAKQIIKIFSTLFDWSIDELTESYNQTGDVSETICSFLLKFDG
DRKKTKMTNQMVDEWLEKLSELTREKDQQSHFSKIRELVSCLELKYIIRLIMKDLRINAG
AKHILEGLRKGAYEMFQHSRNLQTVIEKCQQTDKEELLESGIILNTPVKPMLAEPCRDVK
QAMEKCSKEMYAEIKYDGERLQLHKDGSNFRFFSRSLKPALDHKVVDLNKVVSEAFPTSR
DLIVDTEMLLIDTNTGKPLPFGTLGIHKKSSSRMRQSLRERRKFLEDNMKEVPNRVLLSN
CNLIKKGETDKLEMLIWKAIDEGLEGLVLKDLDSVYEPGKRHWLKVKKDYLKGGDMADSA
DLVLLGAFYGTGNKGGTMSVFLMGVYDKEKRKFCTVTKCGNGHDDATLDRINKELEPKMH
KISRVYENLPEWIDCSRSLVPDFIVIDPKESPVWEIAGAEFTRSDNHTASGISIRFPRVI
KIRDDKNWETATSLQELERLFELSKPKTDIESTIDDTIPLYAASKNDAKDGKVLTARKRK
RDAVTENPKNDEEVAADNVKEDGADSDEEVERKKAKIPCKYGAQCYRKNVEHRKQFEHPK
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgtcatcaaaatttgggcttgattatgctaaacgtgttgctaaatgtaagaaatgccag
cagcaattattgaaaggggatttacgaatgtggagaatggtgccaaatccttttacggca
gattctggaaatccaacggaaatgaaaaattattttcacatagattgtcttttcgaaaca
cttacacgttcccgtgctacaacgaaagtcattgattcaccggatgatatcgaaggttgg
gatgttgcaaatgatgatgacaaagcaagcatcatagagaaaattagggatctttcggaa
ttgcgactgaaaaaatttggagataaagtgaagacttcagcatcaaaagatactctcaaa
aaagccgttgctaaggatatatcctcaaaaaaagtaaaggacgagaaagtggaaacggtc
atatctgctcgaaagaaagaaaaatataaaactgccaagaaagattcgaaggaaataact
tccagaaaagttggtgatagcaaaacaagtgtttccactgtgaaaaacgaacaatcaaca
gcagaaatcttagaaacaagtaaaacagaggatagtattcaaaagataggaagcaaattc
gatatgttcaaattattttgcaaactttgtgatgtaattgcttcggtatcgaagtacacc
gagaagactgaagctgttaaaatattcattaacaaagaaggatatgatggcgatctacac
ttactactcaaatttttaattccagaagcagaccagagaatatacaatttgaaagcaaaa
cagattataaaaatcttttccactctatttgattggtctattgacgaattgacagaatcg
tacaatcaaacaggggatgtatctgagacaatatgctcttttttattgaaattcgatggt
gatcgaaaaaaaacgaaaatgacaaatcaaatggtagatgaatggttagaaaagttgagt
gaattaacacgggaaaaggatcagcagtcacatttctcgaaaatacgtgaattagtctca
tgcctggagttgaagtatattatccgtttgataatgaaagatttgcgtataaatgcaggt
gcgaaacacatattagaaggcttaaggaaaggtgcgtatgaaatgttccagcattcacga
aatttgcaaactgtcattgaaaaatgtcagcagactgataaggaggagttgctagaaagt
ggcataattttaaatacgccagttaaacctatgcttgccgaaccatgccgagacgttaaa
caagcaatggaaaagtgcagcaaagaaatgtatgctgaaatcaaatatgatggagaaaga
ttacaattgcataaagatggtagcaactttaggtttttctcacgatcattgaaaccagca
ttggatcacaaggttgtcgacctgaataaagtagtctcagaagcatttccaacgagcaga
gatttaattgttgatacagaaatgctactgattgatacaaatactggaaaaccgttacct
ttcggaacattaggtatccataaaaaaagcagttcaaggatgcggcaatcattaagggag
cggcgaaaatttttggaggacaacatgaaggaagtgccaaatcgcgtattgttatccaat
tgcaatcttattaagaaaggagaaactgataagttagaaatgttgatttggaaagctatt
gatgaaggtctggaaggtttggtattaaaagatttggattcagtttatgaacctggaaaa
aggcattggttgaaggtaaagaaagattacttgaagggaggtgatatggcagattcagct
gatctcgttttactcggtgctttttatgggacaggaaataaaggcggcacgatgtcagtg
tttttaatgggagtatatgataaggagaagcggaaattttgcacagtaaccaaatgtggc
aatggccatgatgacgccacattagatcgtatcaataaggaattggaaccaaaaatgcat
aaaatatctcgagtatacgaaaatttgccagaatggattgattgctctcgatcgcttgtt
ccagatttcattgttatcgaccctaaagaatcaccagtatgggaaattgcaggagcagaa
tttacacgatcagataaccacacagcgtcaggtatatcgatacgtttcccgagagtaata
aaaattcgagatgataaaaattgggaaacggctactagcttgcaagaacttgagagatta
tttgaactttcgaaaccaaaaaccgacattgaatcaacaattgatgataccatacctctt
tatgcagctagtaaaaatgatgcaaaagacggaaaagttttaacagcaagaaaaaggaaa
cgagatgcggttaccgaaaatcctaagaatgacgaagaagttgctgctgacaatgtgaag
gaagatggtgcagatagcgatgaggaagtggagagaaagaaagcaaaaataccatgcaaa
tatggtgcacaatgttatcgaaagaacgtggaacatcgaaagcaatttgaacatccgaaa
tga

DBGET integrated database retrieval system