KEGG   Loa loa (eye worm): LOAG_18631
Entry
LOAG_18631        CDS       T02664                                 

Name
(RefSeq) Not1 domain-containing protein
  KO
K12580  CCR4-NOT transcription complex subunit 3
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_18631
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_18631
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_18631
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_18631
SSDB
Motif
Pfam: Not3 NOT2_3_5
Other DBs
NCBI-GeneID: 9945037
NCBI-ProteinID: XP_020304935
AA seq 789 aa
MAEKRKLLNEIDKCFKKVEEGVELFEETMAKMQEANSDNQREKFQDDLKKEIKKLQRLRD
QIKGWQNSSDIKDKDKLTSYRKLIEQRMEQFKDIERENKTKPHSKQGLSAEEKLDPREKE
KTETVEWLQCQIRYMEDEADKTESQIESLSTADQTRKKGKRDDPKKGEKEKLKRLDDLRK
HLERIRFHVSKLEICMRLVNNETLESKRVMDALKEPFEMYIESLDPESENDPESFDPETT
GVYDELDLQSYTPQLGGAIFGSADSDEKMENNVDGRISPAASPAPVLPKEVDDNTTKQRH
LSGEPNVLLTRQTSASRSTPATPLKLTNQASGESSLSSPPPPATPPPPPGIPYSVAVGLG
TKNTKGSIVQTSVKQPVEVVRQSPGIISVTTTTTTTSSVAQQQQQQQQQQQQQQQQIAIS
GVVQQQQQQQQQQQEQQQQLPQQQQPQQPQQQPQQQPQQHQPTAPVNDENAIPSSLHIDL
PSSVSSQATAALSSGILPTSRSSTPDSNVAKHFSVSSSTSSQHEIATLKSMAAQASSLQN
SVTNTAALNMPSSTVAHSTTLVTSQVNSKTSSALNMITVTASAAAVNATTVSLQNNVVGN
DTDQNALRQVLRMNTTQDIRNHLPQTAVIPAWLGASPLGRSPVMPEYETQLKLLEHALSR
TPLPMDSEKPRSYLPKMPCVTAAYYPQAPLINADTLEYYLRLSPETLFFAFYYMEGSRAQ
LLAAKALKKLSWRFHTKYLMWFQRHEEPKQITDDYEQGTYVYFDYEKWSQRKKEQFTFEY
RYLEDKDFD
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggccgagaaacgaaaactgctcaatgaaattgataaatgtttcaaaaaggttgaggaa
ggtgtggaattatttgaagaaacaatggccaaaatgcaggaagcgaatagtgataatcag
agggagaagtttcaggatgatttgaagaaagaaataaagaagttgcaaaggctaagagat
caaatcaagggttggcaaaattcatctgatatcaaggataaagataaattgacctcttat
cggaagttaatagaacaaaggatggagcagttcaaagatattgaaagggaaaataaaacc
aaaccacacagcaagcagggattatcagccgaagaaaagcttgatccgcgggaaaaagaa
aaaacagaaactgtggaatggttgcagtgccaaatacgatatatggaggacgaagccgat
aagacggaatcgcaaattgaatctttgtcaacagccgatcaaactagaaagaaaggtaaa
agggatgatccgaagaaaggcgagaaagagaagttgaaacgactagatgatttgagaaaa
cacttggaacggataaggtttcatgtgtcaaagttggaaatctgtatgaggcttgttaat
aacgaaacattggaaagtaagagagtaatggatgcattgaaagaaccttttgaaatgtat
atcgaatctttggatcccgaaagtgagaatgatcctgagtcatttgatcccgaaacaaca
ggggtttatgatgagttagatctgcaatcatatacgccgcaattgggtggtgctattttt
ggttctgctgattctgatgaaaaaatggaaaacaatgtggatgggagaatatcaccagct
gcatcacctgcaccggtcttaccaaaggaagtggacgacaatacaacaaaacaaagacat
ttgagcggcgagcccaatgtactcctgacacgacaaacatcagccagcagaagtacgcca
gctacaccgttaaagctcacgaatcaagcgagtggtgaaagttcgcttagttcaccgccg
ccaccagctacaccaccaccacctccaggaataccatacagcgtggctgttggacttggg
acgaaaaacaccaagggaagcattgtacaaacaagtgtaaagcaaccagttgaagtggta
cgacagtcgccgggcattatttctgtgacaacaacaacaacaactaccagttcagttgca
cagcaacagcaacagcaacaacaacaacaacaacagcaacaacaacaaattgcaatatct
ggagtagtgcagcagcagcagcagcagcaacaacaacagcaagagcaacagcaacaacta
ccacaacaacaacaaccacaacagccacaacaacaaccgcaacaacaaccacagcaacac
cagccaacggctcctgtaaacgatgaaaacgcaattccatcatcactgcatattgacttg
ccatcaagtgtatcatcacaggcaacagcagcattaagttcaggaatactgccaacatca
cgatcctcaacaccggattccaatgttgctaaacatttttccgtttcgagttcaacaagt
agccagcatgagattgctacgttgaagtcaatggcggcacaggcatcatcactgcaaaat
tcggtaacaaatacggccgctttaaacatgccatcgtcaactgtggcacattccacaaca
ctggtaacttctcaagtgaacagcaagacgagtagtgcgttgaatatgattaccgtaact
gcaagtgcagctgcagtaaatgcaactacggtatcattacaaaataatgtagtaggaaat
gacactgatcagaatgccttgcgacaggtcttgcggatgaataccacgcaggatatccga
aatcacttaccgcaaacggccgtgataccagcgtggcttggggcatcaccactaggccgt
tcaccggtaatgccagagtatgaaacgcagctgaaattgttagaacatgcgctctctcga
acaccattaccgatggattccgagaaaccacgaagttatttgccgaaaatgccatgcgtt
accgcagcttattatccgcaagcgccattaatcaatgcggatacattagagtactacctc
cgattgagtccagagacacttttcttcgctttttattatatggagggttcacgtgcacaa
ctactagcggcaaaagcgttgaaaaagctttcatggcgatttcacacgaaatatttgatg
tggttccagcgacatgaggaaccgaagcaaataactgatgattatgagcaaggtacatat
gtgtatttcgattatgagaaatggtcccaacgtaagaaggagcagtttacattcgaatat
cgatatctggaagataaagatttcgattaa

DBGET integrated database retrieval system