KEGG   Loa loa (eye worm): LOAG_18762
Entry
LOAG_18762        CDS       T02664                                 

Name
(RefSeq) Cnot4-prov protein
  KO
K10643  CCR4-NOT transcription complex subunit 4 [EC:2.3.2.27]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_18762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:loa03000]
    LOAG_18762
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_18762
   04121 Ubiquitin system [BR:loa04121]
    LOAG_18762
Enzymes [BR:loa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     LOAG_18762
Transcription factors [BR:loa03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    LOAG_18762
Messenger RNA biogenesis [BR:loa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     LOAG_18762
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     LOAG_18762
Ubiquitin system [BR:loa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    LOAG_18762
SSDB
Motif
Pfam: zf-RING_4 RRM_1 zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 DZR_2 zf-UDP zf-C3HC4
Other DBs
NCBI-GeneID: 9948968
NCBI-ProteinID: XP_020304794
AA seq 754 aa
MSSDEQSDKECPLCMEALEIDDINFYPCKCEYQICRFCWHRLRTDENGLCPACRQPYPED
PVNFKPLTASDVQKMKTEKRQKQQLQKIKICESRKHLSSYRVLQKNLVYVVGLSARVADP
ETLKKPEYFGKYGRILKVAVGSSPSLSGPQSASCTAYVTYARYEDALRAIQAVNNAQLDG
RIVKASLGTTKYCTNFLRSQPCYKPECMYLHDVADTEVSFTKDDMHLGRHAEYEKRLIES
TLREKSQRGRTSFMINTDGKTSNESAERGLHFRSVRIENSQDKGKSSQGRSPSNDMKIAA
NQVNGEVSKNQPCSVINNKRISENKGSDKENEARSQLEKTSGITNDAPLSAMLEQQAVIP
VTKVNEGIGSRSRLSEWISSSQSVMPRTATTCASIEKMFLNTKEKADVSSAKALLNNNSS
QSTNDIPPCDWQRALGICGKVDNLTAKNAITDFSTALSSSQTRMLPKSTRLSVYSDDDLG
FDPISESAKGLADLLEEEKTILPQCSTQNAGGMTSVSSSLMSLGLQCGWPSMGISNGASP
MLVRNALGTDVDLTTTATNNYANVDCFSQPLKFSSQTAQTFNQQLSSVFHTSQYSSHPYF
PPSKPQMARVGNFVNPPSNLVFNPAQPQRCPSFSSNTQFHSNVSLAAANQIDGTKLHEWQ
EGFRALLPNVNVRFVSDLSTAGYPPSRTSPMEMQRTTNQFSSTLNYDQTMPMSAQLLNPM
ASPAPPPVPTINSYPHSSQQWMMPPPGFSYVSKR
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgtctagtgatgagcaatccgataaagagtgtcctttgtgcatggaagcactcgaaatc
gatgatatcaatttttacccgtgcaaatgtgaatatcagatatgtagattttgttggcac
cgattgcgaactgatgagaatggattatgtccggcatgtagacaaccgtatccggaagat
cctgtcaacttcaaacctctgactgcttcagatgttcagaagatgaaaacagaaaagcgt
caaaaacagcaactgcaaaagatcaagatatgtgagtctaggaaacatctatcttcatac
agagtgctacaaaagaatctcgtgtatgtagtgggcttatcggccagagttgcagatccg
gaaactttgaagaaacccgagtattttggaaaatatggccgcatactgaaggttgctgtg
ggatcttcaccatcactgagcggtccacagtcggcatcatgcacagcttatgtaacttac
gcgagatatgaagatgcacttagagctatacaggctgttaataatgcacagttagatgga
cgtattgtaaaggcatcacttgggacgacaaaatattgtacaaattttcttcgcagtcag
ccgtgttataaaccggaatgtatgtatttgcatgacgtggcggatacagaagtgagtttt
acgaaagatgatatgcatcttgggcgacatgcagaatacgaaaaacgactgattgaatca
actctcagggagaaaagtcaacgtggaaggacttcgtttatgataaatacggatggaaaa
acatcaaatgaaagcgctgagcgtggactgcactttcgctcagtgcggatagagaatagt
caggataaaggaaaatcctcacaaggtagatcaccgtcgaatgatatgaagatagctgca
aaccaagtgaatggagaagtatcaaaaaatcagccgtgttctgtgataaataataagcga
attagtgagaataaaggttcagataaagagaacgaagcccggtctcagctagaaaaaact
tcgggaataacaaatgatgcgccattgtctgcaatgcttgagcagcaagcggtgattccc
gtcacaaaagttaatgagggaattggttcaagatctcggttgtcagaatggatttcatct
agtcaaagtgtcatgccgcgtactgctaccacatgcgcttcgatagagaaaatgttctta
aacactaaggagaaagcagatgtgagcagtgcgaaagcgctattgaataacaacagttca
cagtcgacaaatgatattccaccatgtgattggcaacgtgcactaggaatctgtggaaaa
gttgataatttgacagcaaagaatgcgatcactgatttctcgacagcattgtctagttca
caaactagaatgttgccgaaaagcacacggctcagtgtatatagtgatgatgatttaggc
tttgatcctatttcggagtctgcgaaaggtttagcagatttgttggaggaagagaaaacg
attttgccgcaatgctcaacacagaatgctggtgggatgacatctgtatcatcgtcactg
atgtcactgggtctgcagtgtggttggccttcaatgggtatttcgaatggtgcttctccg
atgttggtgagaaatgcacttggaacagatgttgatttaacaacaacggcaacgaacaat
tacgccaatgtcgattgtttttcacagccactaaaattttcttcgcaaaccgctcagaca
ttcaaccaacaactgtcgtcggtatttcacactagtcagtactcgtcacatccgtatttt
ccaccttcaaaacctcagatggctcgagtcggtaatttcgtgaatccacccagtaatttg
gtcttcaatccagcacagccacaacgatgcccttccttcagcagtaacacacagtttcac
tcaaacgtttctctggctgcagcaaaccaaattgatggtaccaagcttcacgaatggcag
gaaggtttccgggcgctgttaccgaatgtaaatgttcgttttgtatcggatcttagtact
gcaggttatccccctagtcggacatcacctatggaaatgcaacgcaccaccaatcaattt
tcgtcaaccttaaattatgatcaaacgatgccgatgtcggcgcaactcctgaatccaatg
gcatcacccgccccgccaccagtaccaactataaattcctaccctcattcatcacaacag
tggatgatgcctccacccggtttttcgtacgtttccaagcgatga

DBGET integrated database retrieval system