KEGG   Loa loa (eye worm): LOAG_18896
Entry
LOAG_18896        CDS       T02664                                 

Name
(RefSeq) 3' exoribonuclease family
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
loa  Loa loa (eye worm)
Pathway
loa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:loa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LOAG_18896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:loa03019]
    LOAG_18896
   03016 Transfer RNA biogenesis [BR:loa03016]
    LOAG_18896
Enzymes [BR:loa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     LOAG_18896
Messenger RNA biogenesis [BR:loa03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LOAG_18896
Transfer RNA biogenesis [BR:loa03016]
 Prokaryotic type
  tRNA degradation factors
   LOAG_18896
SSDB
Motif
Pfam: PPP4R2 RNase_PH RNase_PH_C PNPase KH_1
Other DBs
NCBI-GeneID: 9948492
NCBI-ProteinID: XP_020304645
AA seq 985 aa
MVQVLATVVGRHSSTSDTADFMPLTVDFQQSASAVGRIPTNYLRRELQRNDADILASRMI
DRSIRPLFPKDYSGETQIICKPLAVDDDGDPVMLGLNAASAALTLSDIPWEGPLGAVRIA
LINNEIVVNPSRKNMKISSLDLVIAACDDGNRILMIDMDGCETGIEKFAACIETGLQAIS
YLIQAINKVRDSCGRQKRQNICGEIDIDMIALMEEMQILYGDQLYHILTDIEHDKLSRDR
AVSALGNHMLESLKERSTPHKLRHTFTNLLKKSLREALFKSERRCDGRKFDELRPVDIKM
DVHKKLHGSALFQRGQTQVFSTVTFDAPSAAFQPDALSQLLEDFPYCLRLACDVLESNGS
SSMASVCAGCLALLDAGVQMKTPAAGVAMGLIIDKERNDYRILTDINGLEDFAGDMDFKI
AGTVRGYTAMQLDLKVPGIKPEVMMESLEQARNGLEHLLQLMRKAQPFCRNHFKSTVPVH
ETIPVEIYKRHIIFRSGGYNAKLIESETGAKISVEDDANISIFAPNKVKLEEAKMMLTKM
FESESEIELVFGAMYKGEITDVLEHGVLVTLHKSMKPILLKNSNLDVRNVAHPKVLGFKV
GQKIIIQYLGRDPNTGPYQQVEQALFQSALLQDPTVTNPYWRAHTVLRSHDHFWNITLRE
ERICGPSSSSSISSKTVSSERQHPMRALCKLCMVQEEETTKESYPTGVPTVHILQRLSVA
LSSFTPPHEMVLERTSKGFSKSPVQEIDEYFELVAKLGRPLFKWEIIRCAFLWKLEQTMS
EMLCIEAESAVTEDDKKMLISDDNLRQQRQFILQKAAEFDGTPFTFQRLCELLISPSRHY
KRTDKYLRALEKNINVVTTITESGERVTGVEPFPGELDISSTLRIEEPFFVQVDECDAPV
ETKLIAAGDYFSRGNESPETIAKELVAGDCAPINLSPSRDAKDELPEIKQENNSEREAEH
GISQTESLTKPEMQNAKLEEMEVGD
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggttcaggtattggctaccgtggtcggaagacacagctcaactagtgatacggcagat
tttatgcccctgacggttgattttcaacagagcgcatcggcagttggtcgtattcctacg
aattatttgcgaagagagttgcaacgaaatgatgctgacattctggcatccagaatgatt
gatcgttcaatcaggccgttgtttccgaaagattactctggtgaaactcagataatatgt
aaacctcttgcggtagacgatgatggggatccggtaatgctagggctgaatgcagcctcg
gcagcgctgactctatcggatataccatgggaagggccacttggagctgtcagaatagct
cttattaataatgagattgttgtcaacccaagtcggaaaaacatgaaaatttcttcactg
gatttggttattgctgcttgcgacgatggaaaccgaatactgatgatcgatatggatggt
tgtgaaactggaatagaaaaatttgccgcgtgtatcgaaactggtctccaagctatttct
tacttaattcaagccattaataaagtgagggattcgtgtggtcgtcaaaaacgacagaat
atttgtggagaaattgatattgatatgatagcgttaatggaagaaatgcaaatattgtat
ggtgatcaattatatcatattttaacggatatcgagcatgacaagctttcacgagatcgg
gctgtttctgcacttggtaatcatatgcttgaaagtcttaaagaaaggagtactccgcat
aaacttcgtcatacttttacgaatctccttaaaaaatcactgagagaggcattgttcaaa
agtgaaaggcgatgtgatggacgaaaatttgatgaacttcgtccagtggatattaaaatg
gatgttcataaaaagctgcacggatcggcacttttccagcgcggtcagacccaggtgttt
agtacagtgacgtttgatgctccatcggctgcgtttcagccagatgcgctgtcgcaacta
cttgaagacttcccctactgcttgagacttgcctgtgatgtcctagaatcaaatggttca
tcttcaatggcatcggtttgtgccggttgtttggcgcttcttgatgcaggagtacaaatg
aagacacctgctgctggtgtagctatgggtttgattattgataaagaacgaaatgattat
cgtatcctgacagatattaatggtttggaagattttgctggagatatggactttaagata
gcaggaacagtacgaggttatacagcgatgcagctggatttgaaagtgccaggcataaag
ccagaagtgatgatggaatctctggaacaagcaaggaatggactggaacatcttttgcaa
ctaatgaggaaggcgcaacctttctgtcggaatcattttaaaagtacggtcccggtacat
gaaacgatacctgttgaaatctacaaacgccacatcatatttcgtagtggaggctataat
gctaaattgatcgagtcagaaaccggtgctaagataagcgtagaggatgatgcaaacata
tctatcttcgcacctaacaaagtcaagctagaagaagcgaaaatgatgttgaccaaaatg
ttcgagagtgaaagcgaaatagaactagtattcggtgcaatgtacaagggagaaatcaca
gatgtattggagcatggcgtgctggtaacgcttcacaagagcatgaaacctattttactg
aaaaacagcaatttggatgtgaggaacgtagctcatcccaaggtgcttggtttcaaggtc
ggtcaaaaaataattattcaatatctaggacgagatccaaatactgggccttatcaacaa
gtggaacaagcgctgtttcaatcagcactgctacaggaccccacagtcactaatccttat
tggcgtgctcacaccgtcctccgttcgcacgatcatttctggaatatcactctccgagaa
gagagaatctgcggacccagtagtagtagtagtattagtagcaagacggtgtccagtgaa
cggcagcatcccatgcgagcactgtgtaagctttgtatggtacaggaggaggaaacaacg
aaggaatcgtacccaacaggtgttccaactgtgcatatcctacaaagactttctgttgcc
ctttcttccttcactccgcctcacgagatggttttggaaaggacttcaaaaggattttcg
aagtcaccggtgcaagaaattgatgagtatttcgagcttgttgctaaacttggtcgacca
ctttttaaatgggaaataatacgatgtgcattcctttggaaactcgagcaaacaatgtcg
gaaatgctgtgcatcgaggcagaaagtgcagttacagaagatgacaaaaaaatgcttatc
tcagatgataatctgcgtcaacaacgccaatttatcttgcaaaaagctgccgaatttgat
gggacaccttttactttccaaaggctatgtgaacttctgattagtccttctcgacattac
aaacgaacagacaaatatcttcgagctctggaaaagaatatcaatgtggtgacgacaatt
acagagagtggagaacgcgtaacaggagtagagccatttccaggggaactagacattagt
tccacgcttcgcattgaagaaccattttttgtccaggtggatgaatgtgatgcgccagta
gaaacgaaattgattgctgctggagattattttagcagaggaaacgaatctccggaaaca
attgcaaaagaactagtagctggtgattgtgctccaataaacttgtctccatcgcgcgat
gctaaggatgagctgcctgagattaagcaagagaacaactcagagcgcgaagcagaacat
ggcatttcacaaactgaatcactgacgaaaccagaaatgcaaaatgccaaactggaagag
atggaagttggagactag

DBGET integrated database retrieval system