KEGG   Leishmania panamensis: LPMP_160480
Entry
LPMP_160480       CDS       T06539                                 

Name
(RefSeq) fucose kinase, putative
  KO
K25315  arabinokinase / fucokinase / arabinose-1-phosphate guanylyltransferase / fucose-1-phosphate guanylyltransferase [EC:2.7.1.- 2.7.7.- 2.7.1.52 2.7.7.30]
Organism
lpan  Leishmania panamensis
Pathway
lpan00520  Amino sugar and nucleotide sugar metabolism
lpan01100  Metabolic pathways
lpan01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:lpan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LPMP_160480
Enzymes [BR:lpan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     LPMP_160480
    2.7.1.-  
     LPMP_160480
   2.7.7  Nucleotidyltransferases
    2.7.7.30  fucose-1-phosphate guanylyltransferase
     LPMP_160480
    2.7.7.-  
     LPMP_160480
SSDB
Motif
Pfam: Fucokinase GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 22573625
NCBI-ProteinID: XP_010697575
UniProt: A0A088RLI5
Position
16:complement(159868..163551)
AA seq 1227 aa
MSLNFLFSVPRCLAEYSGAKKLLGDAASLTVHEHSAKGDVAAPGLFCGCDPEGKPLGSGG
GTVHLLHECYLDEQRHAPASAKKSFLSWLRLGDKDGRVIVHAGGLSRRLPAYAAVGKALV
PLPPCRWRRGSQLSRTLLSTQMPMYREIITTAPANLRTLIACGDVCVYLRGSLPSFSHFA
DKDVVCFGIRTDTHLLENHGVLFTTCEKPLELDYMLQKPSLAEIRQRTAEGRHSFLLDVG
MWMLSDRAVAILARKCLGRALDTDDVNGGEHDGHRCAVVCNSYELYSEFGTALGRNASQA
DPEVSGLKAGVVELRDAVFLHYGTCRQLISSTAKLQSCESPTPSWSWGTPFDGVLAPECN
DGKEARLPTAAADAPAGDAGEELDFAAGDAVPLLATPSSVIVQNSVLLAPLDGSAAAAAA
AGASAFAPVSPVHHLWAESSWVGARWVLRGQHILTGIPRNDWALALPLGVCVSVVSVLPA
ALGGRGCGDGAALHAARPYHIDDAFRGDVRNGSTVYMGLLLHDWLSSRGFSVAELYPTAR
AADRDTAQPLDISEAALFPVCVTQQQLGDFLYVATLSLEATTGGGAAVDPVRLSAGQAVW
RTQPRVSAMDLLRLADVPAILRNSEYYERRMLTLMLALVGANPVFQGGCSSVVSVPNTPM
ATPALSSVRPSVLSDSMIALLQQQFSLLDLSRVAKRVVELGVTLPRRSGTTEEWDGVDAT
AKTVSLPHQPDSIESFGSDADATASSWARIFTDEKSPNGDRRGAPLCLASGRIVTAHYHM
FVSRVIELALEAMDAAQPPMTAAEKARRLELLHAPSAKEARSLVTRHSATAFAELCAAIV
DSFPGERHNPEIGVHLDQIIWGRCPIRIDLAGAWTDTPPYTILSGGSVINVAVELNGQPP
VQVYVRARKDPTIVILSIDSGEQLRISSFDEIRTYTAVQNSFSIPKAALALCGFLPEFCT
TAYATLTEQLAARFGNHGLEISLFVAIPVGSGLGTSSIVAGTVLQSLAEFCKLPWDVHDV
CRRVLLIEQMLTAGGGWQDQYGGLFEGVKLVQCVPGLPCLPTVRWMPDNVYTDPRFASCH
LLYYTGITRTAKGILTEIVREVFLNSGATLQLLHEIGGATTAAMYNAITTGNYERYARLI
HRTWDQKKRLDSGVCNPAVQSIVDIVEPYVWGLTLPGAGGGGYMYMCAKDEACARRIREL
LTANPPNGNARFVEMSVSSSGLKVSRS
NT seq 3684 nt   +upstreamnt  +downstreamnt
atgagcctgaattttctcttcagcgtcccccgctgcttggcggagtatagtggagcaaag
aagctcctgggggatgcggcctcgttaactgtgcatgagcactctgcgaagggcgacgtg
gcggcgcctgggctgttctgcgggtgcgacccggagggcaagccgctgggctccggcggt
ggcacggtgcacctactgcacgagtgctacttagacgaacagcgtcatgcacctgcatct
gcgaagaagtcgttcctgtcgtggctgcgacttggggacaaggatggccgcgtgattgtg
cacgctggtggcttgagccgccgcctgccggcgtacgcggcagtgggcaaggcactggtg
ccgttgcctccgtgccggtggcgccgtggcagccagctgtctcgcacgctgctctcgacc
caaatgccgatgtaccgtgagatcatcacgacggcgcctgccaacctgcgcacgttgatc
gcgtgcggcgacgtctgcgtgtacctcagaggttctctgccctctttttctcacttcgcg
gataaggatgttgtgtgctttggcattcgtactgacacgcacctcttggagaaccatggc
gtgctcttcacgacatgcgagaagccacttgagctggactacatgctacagaaaccgtcg
ttggccgaaatacgccagcgcaccgccgagggcaggcattcgtttctcttggatgtgggt
atgtggatgctgagcgaccgcgcagtggcgattctggctcgcaagtgccttggcagagcg
ctggacactgatgacgtgaacggcggcgagcatgatgggcaccgctgcgcggtggtgtgc
aactcatacgagctgtactcggagtttggcactgcactgggccggaacgcgtcgcaagca
gatccggaggtctccggactgaaggcgggcgttgtggaactgcgcgatgcggtgtttctg
cactacgggacgtgccgtcagctgatctcgtcgacagcgaagttgcagagctgcgagtct
ccgacgccgtcgtggtcgtggggcacgccgttcgacggtgtacttgcgcctgagtgcaac
gacgggaaggaggcgcggctgcctactgcggctgcggatgcgcccgcgggcgacgcgggg
gaagagctggactttgctgctggcgacgcagtgcctctgcttgcgacgccatcgtcggta
attgtacaaaactctgtgctacttgcacctctggatgggtccgctgccgctgctgctgct
gctggagcatccgcattcgccccggtatcgcctgtgcaccacctctgggcggagagcagc
tgggtgggtgcgcgctgggtgctgcggggtcagcacatcctgacggggatcccgcgcaat
gactgggcgcttgcactgccgcttggtgtgtgcgtgagcgttgtgtctgtgctgcccgct
gcgcttggtgggcgcggctgtggtgacggtgctgcactgcacgctgcgcggccgtaccac
atcgacgacgcgttccgtggagacgtgcgcaacggctcgacggtgtacatggggctgctc
ctgcacgactggctgtcgagtcgaggtttcagcgttgcggagctataccctactgcgcgg
gctgcggacagagataccgcgcaaccgctggacatctccgaggctgcactgttccccgtg
tgcgtgacacagcagcagctcggcgacttcctgtacgttgctacgctttcgctggaggcg
acgactggcggcggcgctgctgtggaccctgtgcgactctctgctggacaggctgtgtgg
cgaacgcagccgcgcgtgtctgcgatggacctgctgcggctggcggacgtgcctgcgata
ctgcgcaacagcgaatactacgagcggcgcatgttgacgctgatgcttgcgctcgtgggt
gctaaccccgtgttccagggtgggtgcagctcggttgtgtctgtgccgaacacgccgatg
gccacgcctgcactgtcgagtgtgcggccgtcggtcttatctgactcgatgatcgcgctg
ctgcagcagcagttctctctgttggacctgagtcgcgttgcaaagcgcgtagtggagctt
ggcgtgacgctgccgcggcgcagcgggacgacggaagagtgggacggggtggacgcaact
gccaagacagtatcgctgccacaccagccagactcgatagagtcatttgggagcgatgcc
gatgctactgcgagtagctgggcacgcatattcacggatgagaagagcccgaacggtgac
cgcaggggcgcgccgctgtgcttggcgtctggacgcatcgtgacggcgcactaccacatg
tttgtgagccgcgtgatagagctcgcgctggaggcaatggatgctgcacagccgccgatg
actgcggcagagaaggcgcggcgccttgagctactgcatgcgccgagcgcgaaggaggcc
cgctcgctagtgactcggcacagtgccactgccttcgcggagctatgcgccgccattgtg
gactcctttcctggtgagcgccacaacccagaaattggtgttcaccttgaccaaatcatc
tggggtcgctgccccatccgtatcgaccttgccggtgcttggacggatacgccgccgtac
acgatcctgagtggcggcagcgtgatcaacgttgctgtggagctgaacgggcagccaccg
gtgcaggtgtacgtgcgtgcacgcaaggacccgaccatcgtcatactctcgatcgactcc
ggcgagcagctgaggatttcgagcttcgacgaaatccgcacgtatacggcggtgcagaat
tcgttctcgattccgaaggctgcacttgcgctgtgcgggttcctgccagagttctgcacg
acggcgtacgcgacgctgacggagcaactggcggcgcggtttggcaaccacgggctggag
atctcactgtttgtggcgatcccagtggggtccggcctggggacgagctccatcgttgcc
ggcaccgtgctgcagtcactggcggagttctgcaagctgccgtgggacgtccacgatgtg
tgccgccgcgtgctgttgattgagcaaatgctgactgctggtggcgggtggcaggatcag
tacggcggcctgttcgagggtgtgaagctggtgcaatgtgtgcctgggctaccgtgcttg
cctactgtgcgctggatgccggataacgtgtacacggacccgaggtttgcttcgtgccac
cttctctactacacggggatcactcggacagcaaagggcattcttacggagattgtgcgt
gaggtgtttctgaacagcggtgcgacgctgcagctactgcatgagataggtggcgctacc
actgccgcaatgtacaacgctatcacgaccggcaactacgaaagatacgcgcggcttatc
caccggacgtgggatcagaagaagcggctggacagcggcgtgtgcaaccctgcagtacag
tcaatcgtggacattgtggaaccgtacgtgtggggtctgacactgcctggcgctggtggt
ggtggctacatgtacatgtgcgcgaaggacgaggcgtgcgctcggcggattcgcgagttg
ttgacagcgaatccgccgaatggcaatgcccgcttcgtggagatgagcgtgtcgtcgtcc
ggtctgaaggttagccgctcttag

DBGET integrated database retrieval system