KEGG   Limosilactobacillus pontis: LP475_03365
Entry
LP475_03365       CDS       T07022                                 

Name
(GenBank) LPXTG cell wall anchor domain-containing protein
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lpon  Limosilactobacillus pontis
Pathway
lpon00500  Starch and sucrose metabolism
lpon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LP475_03365
Enzymes [BR:lpon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LP475_03365
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor
Other DBs
NCBI-ProteinID: QFV00814
UniProt: A0A5P9QH49
Position
680464..682746
AA seq 760 aa
MYKSGKNWVVVTLSTAALALGASVVNANADATTPVTSSTDVPVTESVNSSSAVMSSSSTP
IKSNAAQTATTSQSSADNVQSSDAPKTATPVTKQGNTTTAPAAKTTDSQPADHHQAQLNP
VSSAAKDAEQRSTHLTDKAATVVKNAGIAPNSLTSQQVKELNKVNFSKSAKTGTQMTYND
FKKIANTLIKQDGRYAIPFFNAKQIQNMPAAHTRDAQTGEVTDLDIWDSWPVQDTKTGYV
SNWNGYQLVIGMMGEPNVNDNHIYLLYNKYGDNNLANWKNAGPIFGYNANAVRQEWSGSA
TVNPDGSIQLFYTRVDTSDNYTNHQKLASATIYLDHDDKTGTVSINHVANDHVIFEGDGY
YYQTYKQWRATNNGADNIAMRDAHIIEDNDGNRYLVFEASTGLENYQGLSQLYNWQNYGG
SDKFNVNNFFHLLSNNDMRSRASWANAAIGILKLNNDIKNPQVSELYTPLLTAPMVSDEI
ERPDVVKLGDKYYLFAATRLNRGSNDDAWNAANKAVGDNVVMVGYVSDKLTGGYKPLNDS
SVVLTTSVPANWRTATYSYYAIPVEGHPNQVLITSYITNRNEVAGKNMNSTWAPSFLVQI
NPDNTTMVLARMTNQGDWIWDNTSENDNMAGVLDKNTANSAALPGEWGKPIDWNLVGGDD
LIPHNPGEPDTPNVPNVPNTPDTPNTPNVPDIPNTPNTPNTPDTPNVPNTPNTPREPQTS
NKTETRLPQTGNHNGQVAMGLGFASLLAMFGLVGANKRRY
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgtacaagagtggtaaaaactgggtcgtagtaaccctgtccaccgcagcattggcctta
ggtgcctctgtcgttaatgcaaacgcagacgccactacgcctgttacaagtagtactgat
gtcccggttactgaatccgtcaacagcagttctgccgttatgagttcatcttcgacgcca
attaagtctaacgctgcacagaccgcaacgacttcccagtcaagtgctgataacgttcaa
tcgtccgacgccccaaagacggcaaccccggtaacaaaacaaggcaacaccacaacggca
cctgctgccaaaactaccgacagccaaccagctgaccaccaccaggcacagcttaaccca
gtaagcagcgcagctaaggatgctgagcagcggtccacgcacttaacagacaaggcagcc
acggtagttaagaatgctggtattgccccgaacagcctgacttctcaacaggtcaaggaa
ctgaataaggtcaacttctcgaagtcagccaagaccggtacacaaatgacctacaatgac
ttcaagaagattgctaacacgctgatcaagcaagatggccgttacgcaattccattcttt
aacgctaagcaaattcagaatatgccggccgctcacactcgcgatgcccagaccggtgag
gttactgacctggatatttgggactcatggccagttcaggataccaagaccggctatgtc
tcaaattggaatgggtaccaattagttatcggaatgatgggggaaccaaacgtcaacgat
aatcatatttacctgttgtacaacaagtatggggacaacaacctagccaactggaagaac
gctggtccgatctttggttataacgctaatgcggttcgtcaggaatggtctggttctgca
accgtaaacccagacgggtccattcaattgttctatacacgcgttgacacaagtgataac
tacaccaaccaccagaagttggcgagtgcaacgatctaccttgatcatgatgataagacc
ggaacggtttcaattaatcatgtggccaatgatcacgtcatctttgaaggggatggctac
tactaccagacctacaaacaatggcgtgccactaacaatggagccgacaacattgcaatg
cgtgatgctcatattattgaagataatgacggcaaccgttacctggtatttgaggccagc
acgggacttgaaaattaccagggcttgagtcagctttataattggcaaaactacggaggc
agcgataagtttaacgttaataacttcttccacctgctgtctaataacgatatgcggagc
cgtgcaagttgggccaatgccgctattggtattctgaagcttaataatgacattaagaat
ccacaggtaagtgagctctacacgccattgcttacggcaccgatggttagcgatgagatt
gaacggccggatgttgttaagttaggagacaagtactatctctttgcggcaacgcggttg
aatcgtggtagtaatgatgatgcttggaatgctgccaacaaggctgttggggacaacgtt
gtcatggttggttacgtctccgataagctgacgggtggttacaagcctctgaacgactcc
agtgttgttttgacgacgtcagttccagcaaactggcggaccgctacctattcctactat
gcaatcccagttgaaggacaccctaaccaggtcctgatcacttcctacatcaccaaccgg
aatgaggttgctggtaagaatatgaactcaacctgggctccaagcttcctggttcagatt
aaccctgataacaccacgatggttctcgcacggatgactaaccagggtgattggatctgg
gacaacaccagtgagaatgacaacatggcgggcgttcttgacaagaatactgctaatagt
gcagccctgcctggtgagtggggcaagccaatcgactggaacctggtcggcggcgacgat
ttgatccctcataacccgggtgagccagacacacctaacgttcctaatgttccgaatacg
ccagacacaccaaacacgcctaacgttcctgatatcccgaatacgccaaatacaccaaat
actccggacacaccaaatgtcccgaatacaccaaacacgccgcgtgaaccacagacgtct
aacaagaccgaaactaggttaccacaaaccggcaaccataatggtcaagtagcaatgggc
cttggtttcgcatccctgttggcaatgtttggcctggtgggtgctaataagcgtcgttac
taa

DBGET integrated database retrieval system