KEGG   Lactobacillus paragasseri: LpgJCM5343_12650
Entry
LpgJCM5343_12650  CDS       T05840                                 

Name
(GenBank) levansucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lpw  Lactobacillus paragasseri
Pathway
lpw00500  Starch and sucrose metabolism
lpw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LpgJCM5343_12650
Enzymes [BR:lpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LpgJCM5343_12650
SSDB
Motif
Pfam: Glyco_hydro_68 Gram_pos_anchor
Other DBs
NCBI-ProteinID: BBD48912
Position
complement(1304353..1306659)
AA seq 768 aa
MLENKKHKKMSLSGKSLLMGTLSTAAIVLSASTVNAATNTDTVDNANASQVTTVKASASV
NKNDNSGLKENATNDKVAGTETNLNSSLNSGKETSSQVNDSKEDSSSTQVGSTPISSAII
NNGKASSDLNQDSDNISDHFKDNNSQGQSSTSSEKTELKGKIKEIVNNSGIDVTKLTNDQ
INNLNKVNFDNDPQDGTKLTLNDLDAIGQALIRRDPKYAVPYFNAKEIKNMDAAETKDAQ
TGKTETLEIWDSWPVQDPITGYVSNYKGYQLVIAMMGMPKKNDNHIYLLYNKYNDNEFSH
WRNAGSIFGYNETPDLQEWSGSAIVNKDGSVQLFYTKNDTSNGKLNDQQLATANLKLNVD
NNGVSIASVDNDHVIFIGDGKHYQTYDQFSNGKNRNRDNYTLRDPHVVEEENGDRYLVFE
ANTGSNNYQGEDQVYRWANYGGNDKFNVNNFLSYFGNNDDQALASVANGALGILKLSGDQ
NNPTVKLDDVYSPLVTSLMVSDEMERPDIVKVGNKYYLFSATRLSRGTKGEITRLANKVV
GDNVAMIGFVSDSLTHGYVPLNGSGVVLTASVPANWRTATYSYYAVPIEGKENQLLITAY
MTNRGEVAGKGNNSTWAPSFILQLNPDNTTTVLAKLTNQGVWVWNGDSENKNMIGSLEKD
SPNSAALDGEWGKFIDWDAINSYSLKPHQPVTPNVPTTPEKPENPTTPNTPDTPRTPEVP
TTPVKKTTQSELPKAGAKDGIAATILGAISSMLGVIGLAGISKRKRNN
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgttggaaaataaaaaacataaaaagatgtctttaagcggaaaatctttattaatgggg
accttgtctacagcagcaattgtattaagtgcttccactgtaaatgctgctactaatact
gatactgttgataatgctaatgctagtcaagttaccacagtaaaagcatctgcttcggtt
aacaaaaatgataatagtggattaaaagaaaatgctacgaacgacaaagtagctggaact
gagacaaatctaaactctagtttaaattctggtaaagaaacaagtagccaagttaatgac
agtaaggaagatagttcatcaacacaagtaggaagtactccaatttcttctgcaatcatt
aataatggtaaagcctctagtgatttaaaccaagattctgacaatatttccgatcatttt
aaggataataattctcaagggcaaagttcaacttcttcagagaaaaccgaattaaaggga
aaaatcaaagaaattgttaataattctggtattgatgtcacaaaattaactaatgatcaa
attaataatttaaataaagttaattttgataatgatccacaagacggaacaaaattaaca
ttaaacgatttagatgcaattggacaggctcttataagaagagatccaaaatatgcagtt
ccatattttaatgcaaaagaaataaaaaatatggatgcagcggaaactaaagatgcacaa
actggtaaaactgaaactttggaaatctgggattcgtggccagtacaagaccctataact
ggttatgtatcaaactataagggctaccaacttgtcattgcaatgatgggaatgcctaaa
aagaacgataatcatatttatcttttgtataataaatataatgataatgaattctcgcat
tggagaaatgcgggttctatctttggatataatgaaactcctgatttacaggaatggtca
ggatctgccattgtaaataaagatggttctgttcaactattttatacaaaaaatgataca
tcaaatggtaagctaaatgatcaacagttggcaacagctaatttgaagttaaatgttgat
aacaatggtgtttcaattgctagtgttgataatgatcatgtgatttttattggtgatggt
aaacattatcaaacttatgatcaattctcaaatggtaaaaatagaaatagagataattat
acattacgagatcctcatgtagtggaagaagagaatggtgatcgttatttagtatttgaa
gcaaacactggaagcaataattaccaaggcgaagatcaagtttatagatgggctaattat
ggtggaaatgataagttcaatgtcaataatttcttgagctattttggtaataatgatgat
caagctctcgcttctgtggctaatggtgcactgggaattttaaaattaagtggggatcaa
aacaatccaactgttaagttagatgatgtttactcacctttagtaacgtcattaatggtt
agcgatgaaatggaaagacctgatattgttaaagttggaaataagtattatctattttca
gcaacaagattgtctcgaggaactaaaggagaaattactcggcttgctaataaggttgtt
ggagacaatgtagcgatgattggctttgtttctgatagtttaacgcatggttatgtgcca
ttaaatggttctggtgttgtattaaccgcttcagtacccgcaaattggcgtacggcgaca
tattcatattatgcagttcctattgaaggaaaagaaaatcaacttttaattacagcttat
atgactaatcgtggtgaagtagctggaaaaggtaacaattcgacttgggcaccaagcttt
atcttgcaactgaatccagataatactaccactgttttagccaaattaactaatcaaggt
gtttgggtttggaatggtgatagtgaaaataaaaatatgattggtagtctcgaaaaagat
tctccaaatagtgctgctttagatggagaatggggcaagtttattgattgggatgcaatt
aatagttatagtttgaaaccacatcaacctgtgactccaaatgttccaacaactccagag
aaacctgaaaacccaacaacaccaaatactcctgatactccacgtactccagaagttcca
actactccagttaagaaaactactcagtcagaacttccaaaggcaggagctaaagacggt
attgctgcaacaattttaggtgctataagctcaatgttaggagttatcggtttagcaggt
atttcaaaacgcaagcgtaataactaa

DBGET integrated database retrieval system