KEGG   Lactobacillus reuteri TD1: N134_05395
Entry
N134_05395        CDS       T02745                                 

Name
(GenBank) levansucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00500  Starch and sucrose metabolism
lrr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N134_05395
Enzymes [BR:lrr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     N134_05395
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor
Other DBs
NCBI-ProteinID: AGR65155
UniProt: S5NRZ4
Position
complement(1126101..1128497)
AA seq 798 aa
MLERKEHKKMYKSGKNWAVVTLSTAALVFGATTVNASADTNTENNDSSTVQVTTGDNDIA
VKSVTLGSGQVSAVNDATIKNSANANSASSAANTQNSNSQVASSAATTSSTSSASSSTNT
DSKATKENTNVAKEDDTQKAAPANESSEAKSEPAVNTNDSSVAKNDDQQSSKKNTAAKLN
KDAENVVKKAGIDPNSLTDDQIKALNKINFLKTAKSGTQMTYNDFQKIADTLIKQDGRYT
VPFFKASEIKNMPAATTKDAQTNTIEPLDVWDSWPVQDVRTGQVANWNGYQLVIAMMGVP
NQNDNHIYLLYNKYGDNELSHWKNAGPIFGYNATALSQEWSGSAVLNSDNSIQLFYTRVD
TSDNNTNHQKIASATLYLTDNNGNVSLAQVANDHIVFEGDSYYYQTYDQWKATNKGADNI
AMRDAHVIEDDNGDRYLVFEASTGSENYQGEEQIYNWLNYGGDDAFNIKSLFRILSNDDI
KSRATWANAAIGILKLNKDEKNPKVAELYSPLISAPMVSDEIERPNVVKLGNKYYLFAAT
RLNRGSNDDAWMNANYTVGDNVAMVGYVADSLTGSYKPLNDSGVVLTASVPANWRTATYS
YYAVPVTGKDDQLLVTSYMTNRNGVAGEGMDSTWAPSFLLQINPDNTTTVLAKMTNQGDW
IWDDSSENLGMIGDLDSAALPGERDKPVDWDLIGYGLKPHDPATPNDPETPTTPETPETP
NTPETPKTPENPGTPQTPETPNTPEVPLTPENPKQPETQTNNRLPQTGNNANKAVIGLGM
GTLLSMFGLAGINKRRFN
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgctagaacgcaaggaacataagaaaatgtataaaagcggtaaaaattgggcagtcgtt
acactctctactgctgcgttggtgtttggcgcaacaactgtaaacgcatccgcggacact
aatactgaaaataatgattcttctactgtacaggttacaactggcgataatgatattgct
gttaaaagtgtgacacttggtagtggtcaagttagtgcagttaatgatgcgactattaaa
aattctgctaatgcaaatagtgcttcttctgccgctaatacacaaaattctaacagtcag
gtagcaagttctgctgcaacaacttcatctacaagttcagcatcttcatcaactaacaca
gatagtaaagcaactaaagaaaatactaatgtagctaaagaggatgatacacaaaaagct
gcacccgctaacgaatcttctgaagccaaaagcgaaccggctgtaaacactaatgattct
tcagttgccaaaaacgatgatcaacaatccagtaaaaagaatactgccgctaagttaaac
aaggatgctgaaaacgttgtaaaaaaggcgggaattgatcctaacagtttaactgatgac
cagattaaagcattaaataagattaacttcttgaaaactgcaaaatctggtacacaaatg
acttataatgatttccaaaagattgccgatacgttaatcaaacaagatggtcggtataca
gttccattctttaaagcaagtgaaatcaaaaacatgcctgccgctacaactaaagatgca
caaactaatactattgagcctttagacgtatgggattcatggccagttcaagatgttcgg
acaggacaagttgctaattggaatggctatcaacttgtcatcgcaatgatgggggttcca
aaccaaaatgataatcacatctatctcttatataataagtatggtgataatgaattaagt
cattggaagaatgcaggtccaatttttggctataatgctactgcgctttcacaagaatgg
tcaggatcagctgttttgaacagtgataactctatccaattattttatacaagggtagac
acgtctgataacaataccaatcatcaaaaaattgctagcgctactctttatttaactgat
aataatggaaatgtgtcactcgctcaggtagcaaatgatcatattgtattcgaaggtgat
agctattactaccaaacttatgatcaatggaaagctactaacaagggtgctgataatatt
gcaatgcgtgatgctcatgtaattgaagatgataatggtgatcggtaccttgtttttgaa
gcaagtactggttcagaaaattatcaaggcgaggaacaaatttataactggttaaattat
ggcggagatgacgcctttaatatcaagagcttatttagaattctttccaatgatgatatt
aagagtcgggcaacttgggctaatgcagctatcggtatcctcaaactaaacaaggacgaa
aagaatcctaaagtggcagaattatactcaccattaatttctgcaccaatggtaagtgat
gaaattgaacgaccaaatgtggttaaattaggtaataagtattacttgtttgccgctacc
cgtttaaatcgaggaagtaatgacgatgcttggatgaatgccaattatacggttggtgat
aatgttgcaatggtcggatatgttgctgatagtctaactggatcttataagccgttaaat
gattctggagtggtcttgactgcttctgttcccgcaaactggcgaacagcaacttattca
tattatgctgtccctgttaccggaaaagacgatcaattgttagttacttcatatatgact
aatcgaaatggagtagctggagagggcatggactcgacctgggcaccaagcttcttgtta
caaattaatcctgataatacaactactgttttagctaaaatgactaaccaaggggattgg
atttgggatgattcaagcgaaaatcttggtatgattggtgatttagactccgctgcttta
cctggggaacgtgataaacctgttgattgggacttaattggttatggattaaaaccgcat
gatcctgctacaccaaatgatcctgaaacgccaactacaccagaaacccctgagacgcct
aatactccagaaacaccaaagactcctgaaaatcctgggacacctcaaaccccagagaca
cctaacactccagaagtgcctttaactccagaaaatcctaagcaacctgaaacccaaacc
aataatcgtttgccacaaactggaaataacgctaataaagccgtaattggcctaggtatg
ggaacattgcttagtatgtttggccttgcaggaattaacaagcgtcgattcaactaa

DBGET integrated database retrieval system