KEGG   Lactobacillus reuteri I5007: LRI_0973
Entry
LRI_0973          CDS       T02701                                 

Name
(GenBank) inulosucrase
  KO
K20811  inulosucrase [EC:2.4.1.9]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
lrt00500  Starch and sucrose metabolism
lrt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LRI_0973
Enzymes [BR:lrt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.9  inulosucrase
     LRI_0973
SSDB
Motif
Pfam: Glyco_hydro_68 KxYKxGKxW_sig Gram_pos_anchor
Other DBs
NCBI-ProteinID: AGN99182
UniProt: R9WJH9
Position
990355..992751
AA seq 798 aa
MLERKEHKKMYKSGKNWAVVTLSTAALVFGATTVNASADTNIENNDSSTVQVTTGDNDIA
VKSVTLGSGQVSAASDTTIRTSANANSASSAANTQNSNSQVASSAAITSSTSSAASSNNT
DSKAAQENTNTAKNDDTQKAAPANESSEAKNEPAVNVNDSSAAKNDDQQSGKKNTTAKLN
KDAENVVKKAGIDPNSLTDDRIKALNKMNFSKAAKSGTQMTYNDFQKIADTLIKQDGRYT
VPFFKASEIKNMPAATTKDAQTNTIEPLDVWDSWPVQDVRTGQVANWNGYQLVIAMMGIP
NQNDNHIYLLYNKYGDNELSHWKNVGPIFGYNSTAVSQEWSGSAVLNSDNSIQLFYTRVD
TSDNNTNHQKIASATLYLTDNNGNVSLAQVANDHIVFEGDGYYYQTYDQWKATNKGADNI
AMRDAHVIEDDNGDRYLVFEASTGLENYQGEDQIYNWLNYGGDDAFNIKSLFRILSNDDI
KSRATWANAAIGILKLNKDEKNPKVAELYSPLISAPMVSDEIERPNVVKLGNKYYLFAAT
RLNRGSNDDAWMNANYAVGDNVAMVGYVADSLTGSYKPLNDSGVVLTASVPANWRTATYS
YYAVPVAGKDDQVLVTSYMTNRNGVAGKGMDSTWAPSFLLQINPDNTTTALAKMTNQGDW
IWDDSSENLDMIGDLDSAALPGERDKPVDWDLIGYGLKPHDPATPNDPETPTTPETPETP
NTPKTPKTPENPGTPQTPNTPNTPEIPLTPETPKQPETQTNNRLPQTGNNANKAMIGLGM
GTLLSMFGLAEINKRRFN
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgctagaacgcaaggaacataaaaaaatgtataaaagcggtaaaaattgggcagtcgtt
acactctctactgctgcgctggtatttggtgcaacaactgtaaatgcatccgcggacaca
aatattgaaaacaatgattcttctactgtacaagttacaacaggtgataatgatattgct
gttaaaagtgtgacacttggtagtggtcaagttagtgcagctagtgatacgactattaga
acttctgctaatgcaaatagtgcttcttctgccgctaatacacaaaattctaacagtcaa
gtagcaagttctgctgcaataacatcatctacaagttccgcagcttcatcaaataacaca
gatagtaaagcggctcaagaaaatactaatacagccaaaaatgatgacacgcaaaaagct
gcaccagctaacgaatcttctgaagctaaaaatgaaccagctgtaaacgttaatgattct
tcagctgcaaaaaatgatgatcaacaatccggtaaaaagaatactaccgctaagttaaac
aaggatgctgaaaacgttgtaaaaaaggcgggaattgatcctaacagtttaactgatgac
cggattaaagcattaaataagatgaacttctcgaaagctgcaaagtctggtacacaaatg
acttataatgatttccaaaagattgctgatacgttaatcaaacaagatggtcggtacaca
gttccattctttaaagcaagtgaaatcaaaaatatgcctgccgctacaactaaagatgca
caaactaatactattgaacctttagatgtatgggattcatggccagttcaagatgttcgg
acaggacaagttgctaattggaatggctatcaacttgtcatcgcaatgatgggaattcca
aaccaaaatgataatcatatctatctcttatataataagtatggtgataatgaattaagt
cattggaagaatgtaggtccaatttttggctataattctaccgcggtttcacaagaatgg
tcaggatcagctgttttgaacagtgataactctatccaattattttatacaagggtagac
acgtctgataacaataccaatcatcaaaaaattgctagcgctactctttatttaactgat
aataatggaaatgtatcactcgctcaggtagcaaatgatcatattgtatttgaaggtgat
ggctattactaccaaacttatgatcaatggaaagctactaacaaaggtgccgataatatt
gcaatgcgtgatgctcatgtaattgaagatgataatggtgatcggtaccttgtttttgaa
gcaagtactggtttagaaaattatcaaggcgaggaccaaatttataactggttaaattat
ggcggagatgacgcatttaatatcaagagcttatttagaattctttccaatgatgatatt
aagagtcgggcaacttgggctaatgcagctatcggtatcctcaaactaaataaggacgaa
aagaatcctaaggtggcagagttatactcaccattaatttctgcaccaatggtaagcgat
gaaattgagcgaccaaatgtagttaaattgggtaataaatattacttatttgccgctacc
cgtttaaatcgaggaagtaatgatgatgcttggatgaatgctaattatgccgttggtgat
aatgttgcaatggtcggatatgttgctgatagtctaactggatcttataagccattaaat
gattctggagtagtcttgactgcttctgttcctgcaaactggcgaacagcaacttattca
tattatgctgtccccgttgccggaaaagatgaccaagtattagttacttcatatatgact
aatagaaatggagtagcgggtaaaggaatggattcaacttgggcaccgagtttcttacta
caaattaacccggataacacaactactgctttagctaaaatgactaatcaaggggattgg
atttgggatgattcaagcgaaaatcttgatatgattggtgatttagactccgctgcttta
cctggcgaacgtgataaacctgttgattgggacttaattggttatggattaaaaccgcat
gatcctgctacaccaaatgatcctgaaacgccaactacaccagaaacccctgagacacct
aatactcccaaaacaccaaagactcctgaaaatcctgggacacctcaaactcctaataca
cctaatactccggaaattcctttaactccagaaacgcctaagcaacctgaaacccaaact
aataatcgtttgccacaaactggaaataatgccaataaagccatgattggcctaggtatg
ggaacattgcttagtatgtttggtcttgcagaaattaacaaacgtcgatttaactaa

DBGET integrated database retrieval system